HG10012041.1 (mRNA) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTTTGGGATTAATAGTGTTTAAAGTTGGCTTTCAAGATTCTATAGGCAAACTGGTCAAATGGAATAAAGAAGATGAAACTCCCTGCAACTGGCTTGGTGTCAAACGCAATCATATTTCCAATTCACATCGTCCTGAAGTTGCAATTCCTTCGTGTACTTACTTGCCAACAACAACTTCACCGGTACAATCAACTTTGCTCTTTCTCACCTTAGAGGAAGTCCATCGTTGTGGACATCCAAAAGTTTCTAAGGACCCCCGTCGCATGGTCGTCGGCTTCCCTTGCATACACGCGTTCTATTGA ATGATTTTGGGATTAATAGTGTTTAAAGTTGGCTTTCAAGATTCTATAGGCAAACTGGTCAAATGGAATAAAGAAGATGAAACTCCCTGCAACTGGCTTGGTGTCAAACGCAATCATATTTCCAATTCACATCGTCCTGAAGTTGCAATTCCTTCGTGTACTTACTTGCCAACAACAACTTCACCGGTACAATCAACTTTGCTCTTTCTCACCTTAGAGGAAGTCCATCGTTGTGGACATCCAAAAGTTTCTAAGGACCCCCGTCGCATGGTCGTCGGCTTCCCTTGCATACACGCGTTCTATTGA ATGATTTTGGGATTAATAGTGTTTAAAGTTGGCTTTCAAGATTCTATAGGCAAACTGGTCAAATGGAATAAAGAAGATGAAACTCCCTGCAACTGGCTTGGTGTCAAACGCAATCATATTTCCAATTCACATCGTCCTGAAGTTGCAATTCCTTCGTGTACTTACTTGCCAACAACAACTTCACCGGTACAATCAACTTTGCTCTTTCTCACCTTAGAGGAAGTCCATCGTTGTGGACATCCAAAAGTTTCTAAGGACCCCCGTCGCATGGTCGTCGGCTTCCCTTGCATACACGCGTTCTATTGA MILGLIVFKVGFQDSIGKLVKWNKEDETPCNWLGVKRNHISNSHRPEVAIPSCTYLPTTTSPVQSTLLFLTLEEVHRCGHPKVSKDPRRMVVGFPCIHAFY Homology
BLAST of HG10012041.1 vs. NCBI nr
Match: XP_023539050.1 (probable LRR receptor-like serine/threonine-protein kinase IRK [Cucurbita pepo subsp. pepo]) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-07 Identity = 26/41 (63.41%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. NCBI nr
Match: XP_022941623.1 (probable LRR receptor-like serine/threonine-protein kinase IRK [Cucurbita moschata]) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-07 Identity = 26/41 (63.41%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. NCBI nr
Match: KAG7027857.1 (putative LRR receptor-like serine/threonine-protein kinase IRK, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-07 Identity = 26/41 (63.41%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. NCBI nr
Match: XP_004137674.1 (probable LRR receptor-like serine/threonine-protein kinase IRK [Cucumis sativus]) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-07 Identity = 28/41 (68.29%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. NCBI nr
Match: KAE8650966.1 (hypothetical protein Csa_002046 [Cucumis sativus]) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-07 Identity = 28/41 (68.29%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. ExPASy Swiss-Prot
Match: Q9LZV7 (Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana OX=3702 GN=PXC2 PE=1 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 4.6e-06 Identity = 20/33 (60.61%), Postives = 23/33 (69.70%), Query Frame = 0
BLAST of HG10012041.1 vs. ExPASy Swiss-Prot
Match: Q9LY03 (Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana OX=3702 GN=IRK PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 3.0e-05 Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 0
BLAST of HG10012041.1 vs. ExPASy Swiss-Prot
Match: O49318 (Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana OX=3702 GN=At2g33170 PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.9e-04 Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = 0
BLAST of HG10012041.1 vs. ExPASy TrEMBL
Match: A0A6J1I668 (probable LRR receptor-like serine/threonine-protein kinase IRK OS=Cucurbita maxima OX=3661 GN=LOC111470000 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.1e-08 Identity = 26/41 (63.41%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. ExPASy TrEMBL
Match: A0A5D3DMN8 (Putative LRR receptor-like serine/threonine-protein kinase IRK OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G00150 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.1e-08 Identity = 28/41 (68.29%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. ExPASy TrEMBL
Match: A0A5A7TRM1 (Putative LRR receptor-like serine/threonine-protein kinase IRK OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold236G005930 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.1e-08 Identity = 28/41 (68.29%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. ExPASy TrEMBL
Match: A0A0A0LF35 (Protein kinase domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G728030 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.1e-08 Identity = 28/41 (68.29%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. ExPASy TrEMBL
Match: A0A6J1FSM0 (probable LRR receptor-like serine/threonine-protein kinase IRK OS=Cucurbita moschata OX=3662 GN=LOC111446924 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.1e-08 Identity = 26/41 (63.41%), Postives = 33/41 (80.49%), Query Frame = 0
BLAST of HG10012041.1 vs. TAIR 10
Match: AT5G01890.1 (Leucine-rich receptor-like protein kinase family protein ) HSP 1 Score: 52.0 bits (123), Expect = 3.3e-07 Identity = 20/33 (60.61%), Postives = 23/33 (69.70%), Query Frame = 0
BLAST of HG10012041.1 vs. TAIR 10
Match: AT3G56370.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 49.3 bits (116), Expect = 2.1e-06 Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 0
BLAST of HG10012041.1 vs. TAIR 10
Match: AT2G33170.1 (Leucine-rich repeat receptor-like protein kinase family protein ) HSP 1 Score: 46.6 bits (109), Expect = 1.4e-05 Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = 0
BLAST of HG10012041.1 vs. TAIR 10
Match: AT3G28040.1 (Leucine-rich receptor-like protein kinase family protein ) HSP 1 Score: 43.5 bits (101), Expect = 1.2e-04 Identity = 18/37 (48.65%), Postives = 22/37 (59.46%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|