
HG10008949.1 (mRNA) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACATGAAAGAGAAGAAACTGACAGTAACAGGAGATGTAGATCCAGTAGTGATTGTTAGCAAACTAAGGAAAATTTGTCACACAGTGATAGTTTCAGTTGGACCAGAGAAAGAAGAGAAGAAACCAGAGCCAGCAAAGAAAGAAGAGCCAAAGAAGGAAGATCCAAAAAAGGCAGCTGAGGAAAAGAAGAAAGAAGAACAGAAACTTGCTGAGTGCATCAAAACTTTGCAAGCCTATAATAATCTCCATTACAATCCACCAATTTTCTACCCTCCTAGATGCTTTAGCATTGAAGAAGATCCAAATGGTTGTGTTATTTGTTAA ATGGACATGAAAGAGAAGAAACTGACAGTAACAGGAGATGTAGATCCAGTAGTGATTGTTAGCAAACTAAGGAAAATTTGTCACACAGTGATAGTTTCAGTTGGACCAGAGAAAGAAGAGAAGAAACCAGAGCCAGCAAAGAAAGAAGAGCCAAAGAAGGAAGATCCAAAAAAGGCAGCTGAGGAAAAGAAGAAAGAAGAACAGAAACTTGCTGAGTGCATCAAAACTTTGCAAGCCTATAATAATCTCCATTACAATCCACCAATTTTCTACCCTCCTAGATGCTTTAGCATTGAAGAAGATCCAAATGGTTGTGTTATTTGTTAA ATGGACATGAAAGAGAAGAAACTGACAGTAACAGGAGATGTAGATCCAGTAGTGATTGTTAGCAAACTAAGGAAAATTTGTCACACAGTGATAGTTTCAGTTGGACCAGAGAAAGAAGAGAAGAAACCAGAGCCAGCAAAGAAAGAAGAGCCAAAGAAGGAAGATCCAAAAAAGGCAGCTGAGGAAAAGAAGAAAGAAGAACAGAAACTTGCTGAGTGCATCAAAACTTTGCAAGCCTATAATAATCTCCATTACAATCCACCAATTTTCTACCCTCCTAGATGCTTTAGCATTGAAGAAGATCCAAATGGTTGTGTTATTTGTTAA MDMKEKKLTVTGDVDPVVIVSKLRKICHTVIVSVGPEKEEKKPEPAKKEEPKKEDPKKAAEEKKKEEQKLAECIKTLQAYNNLHYNPPIFYPPRCFSIEEDPNGCVIC Homology
BLAST of HG10008949.1 vs. NCBI nr
Match: XP_038906483.1 (heavy metal-associated isoprenylated plant protein 39-like [Benincasa hispida]) HSP 1 Score: 193.4 bits (490), Expect = 1.0e-45 Identity = 100/108 (92.59%), Postives = 102/108 (94.44%), Query Frame = 0
BLAST of HG10008949.1 vs. NCBI nr
Match: XP_008437534.1 (PREDICTED: FK506-binding protein 4-like [Cucumis melo] >ADN33773.1 metal ion binding protein [Cucumis melo subsp. melo] >KAA0042592.1 FK506-binding protein 4-like [Cucumis melo var. makuwa] >TYK05995.1 FK506-binding protein 4-like [Cucumis melo var. makuwa]) HSP 1 Score: 170.6 bits (431), Expect = 7.3e-39 Identity = 92/108 (85.19%), Postives = 96/108 (88.89%), Query Frame = 0
BLAST of HG10008949.1 vs. NCBI nr
Match: XP_004145901.1 (heavy metal-associated isoprenylated plant protein 39 [Cucumis sativus] >KGN49919.1 hypothetical protein Csa_000191 [Cucumis sativus]) HSP 1 Score: 169.5 bits (428), Expect = 1.6e-38 Identity = 95/112 (84.82%), Postives = 98/112 (87.50%), Query Frame = 0
BLAST of HG10008949.1 vs. NCBI nr
Match: KAG7016852.1 (Heavy metal-associated isoprenylated plant protein 12, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 167.2 bits (422), Expect = 8.0e-38 Identity = 91/107 (85.05%), Postives = 96/107 (89.72%), Query Frame = 0
BLAST of HG10008949.1 vs. NCBI nr
Match: XP_022922258.1 (heavy metal-associated isoprenylated plant protein 39-like [Cucurbita moschata] >XP_023549811.1 heavy metal-associated isoprenylated plant protein 39-like [Cucurbita pepo subsp. pepo] >KAG6579367.1 Heavy metal-associated isoprenylated plant protein 12, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 167.2 bits (422), Expect = 8.0e-38 Identity = 91/107 (85.05%), Postives = 96/107 (89.72%), Query Frame = 0
BLAST of HG10008949.1 vs. ExPASy Swiss-Prot
Match: O03982 (Heavy metal-associated isoprenylated plant protein 39 OS=Arabidopsis thaliana OX=3702 GN=HIPP39 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-09 Identity = 62/149 (41.61%), Postives = 73/149 (48.99%), Query Frame = 0
BLAST of HG10008949.1 vs. ExPASy Swiss-Prot
Match: Q9LTE3 (Heavy metal-associated isoprenylated plant protein 12 OS=Arabidopsis thaliana OX=3702 GN=HIPP12 PE=3 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.3e-08 Identity = 43/108 (39.81%), Postives = 57/108 (52.78%), Query Frame = 0
BLAST of HG10008949.1 vs. ExPASy Swiss-Prot
Match: Q9LTE2 (Heavy metal-associated isoprenylated plant protein 13 OS=Arabidopsis thaliana OX=3702 GN=HIPP13 PE=2 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 6.0e-04 Identity = 47/111 (42.34%), Postives = 58/111 (52.25%), Query Frame = 0
BLAST of HG10008949.1 vs. ExPASy TrEMBL
Match: A0A5D3C3P0 (FK506-binding protein 4-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold376G00920 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 3.5e-39 Identity = 92/108 (85.19%), Postives = 96/108 (88.89%), Query Frame = 0
BLAST of HG10008949.1 vs. ExPASy TrEMBL
Match: E5GBD2 (Metal ion binding protein OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 3.5e-39 Identity = 92/108 (85.19%), Postives = 96/108 (88.89%), Query Frame = 0
BLAST of HG10008949.1 vs. ExPASy TrEMBL
Match: A0A1S3ATX5 (FK506-binding protein 4-like OS=Cucumis melo OX=3656 GN=LOC103482919 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 3.5e-39 Identity = 92/108 (85.19%), Postives = 96/108 (88.89%), Query Frame = 0
BLAST of HG10008949.1 vs. ExPASy TrEMBL
Match: A0A0A0KM33 (HMA domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G140450 PE=4 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 7.8e-39 Identity = 95/112 (84.82%), Postives = 98/112 (87.50%), Query Frame = 0
BLAST of HG10008949.1 vs. ExPASy TrEMBL
Match: A0A6J1E630 (heavy metal-associated isoprenylated plant protein 39-like OS=Cucurbita moschata OX=3662 GN=LOC111430294 PE=4 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 3.9e-38 Identity = 91/107 (85.05%), Postives = 96/107 (89.72%), Query Frame = 0
BLAST of HG10008949.1 vs. TAIR 10
Match: AT1G01490.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.2e-10 Identity = 62/149 (41.61%), Postives = 73/149 (48.99%), Query Frame = 0
BLAST of HG10008949.1 vs. TAIR 10
Match: AT1G01490.2 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.2e-10 Identity = 62/149 (41.61%), Postives = 73/149 (48.99%), Query Frame = 0
BLAST of HG10008949.1 vs. TAIR 10
Match: AT5G52740.1 (Copper transport protein family ) HSP 1 Score: 58.5 bits (140), Expect = 3.7e-09 Identity = 43/108 (39.81%), Postives = 57/108 (52.78%), Query Frame = 0
BLAST of HG10008949.1 vs. TAIR 10
Match: AT5G23760.1 (Copper transport protein family ) HSP 1 Score: 51.2 bits (121), Expect = 6.0e-07 Identity = 36/68 (52.94%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of HG10008949.1 vs. TAIR 10
Match: AT5G52750.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 45.1 bits (105), Expect = 4.3e-05 Identity = 47/111 (42.34%), Postives = 58/111 (52.25%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|