HG10002425.1 (mRNA) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAAGCTGACAATGATTGCCCGTGTTACTGACGGTCTTCCTCTTGCTGAGGGACTAGATGATGGTCGTGATTTGAAAGATGCTGAATATTACAAGCAGCAAGCCAAAGCGTTGTTTAAGAACTTATCAAGAGGACAGAATGAGGCTTCGAGGATGTCTATTGAAACCGGCTCTTATGTCTTTCAGTATCCTTGCAACATGCAAGATTATTTTCTGTGCAATCTTAGATTAGAGTATCAAATGCCCTAG ATGGTGAAGCTGACAATGATTGCCCGTGTTACTGACGGTCTTCCTCTTGCTGAGGGACTAGATGATGGTCGTGATTTGAAAGATGCTGAATATTACAAGCAGCAAGCCAAAGCGTTGTTTAAGAACTTATCAAGAGGACAGAATGAGGCTTCGAGGATGTCTATTGAAACCGGCTCTTATGTCTTTCAGTATCCTTGCAACATGCAAGATTATTTTCTGTGCAATCTTAGATTAGAGTATCAAATGCCCTAG ATGGTGAAGCTGACAATGATTGCCCGTGTTACTGACGGTCTTCCTCTTGCTGAGGGACTAGATGATGGTCGTGATTTGAAAGATGCTGAATATTACAAGCAGCAAGCCAAAGCGTTGTTTAAGAACTTATCAAGAGGACAGAATGAGGCTTCGAGGATGTCTATTGAAACCGGCTCTTATGTCTTTCAGTATCCTTGCAACATGCAAGATTATTTTCTGTGCAATCTTAGATTAGAGTATCAAATGCCCTAG MVKLTMIARVTDGLPLAEGLDDGRDLKDAEYYKQQAKALFKNLSRGQNEASRMSIETGSYVFQYPCNMQDYFLCNLRLEYQMP Homology
BLAST of HG10002425.1 vs. NCBI nr
Match: KAE8650885.1 (hypothetical protein Csa_000865 [Cucumis sativus]) HSP 1 Score: 157.5 bits (397), Expect = 4.9e-35 Identity = 75/83 (90.36%), Postives = 79/83 (95.18%), Query Frame = 0
BLAST of HG10002425.1 vs. NCBI nr
Match: MBA0779298.1 (hypothetical protein [Gossypium trilobum]) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-25 Identity = 60/73 (82.19%), Postives = 64/73 (87.67%), Query Frame = 0
BLAST of HG10002425.1 vs. NCBI nr
Match: MBA0840405.1 (hypothetical protein [Gossypium armourianum]) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-25 Identity = 60/73 (82.19%), Postives = 64/73 (87.67%), Query Frame = 0
BLAST of HG10002425.1 vs. NCBI nr
Match: MBA0812213.1 (hypothetical protein [Gossypium harknessii]) HSP 1 Score: 125.6 bits (314), Expect = 2.1e-25 Identity = 60/73 (82.19%), Postives = 64/73 (87.67%), Query Frame = 0
BLAST of HG10002425.1 vs. NCBI nr
Match: RYQ85624.1 (hypothetical protein Ahy_B10g105193 isoform E [Arachis hypogaea]) HSP 1 Score: 124.4 bits (311), Expect = 4.6e-25 Identity = 61/65 (93.85%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy Swiss-Prot
Match: Q94AU2 (25.3 kDa vesicle transport protein OS=Arabidopsis thaliana OX=3702 GN=SEC22 PE=2 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 3.1e-24 Identity = 53/64 (82.81%), Postives = 59/64 (92.19%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy Swiss-Prot
Match: Q5ZJW4 (Vesicle-trafficking protein SEC22b OS=Gallus gallus OX=9031 GN=SEC22B PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.3e-06 Identity = 29/65 (44.62%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy Swiss-Prot
Match: O75396 (Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4) HSP 1 Score: 53.5 bits (127), Expect = 1.3e-06 Identity = 29/65 (44.62%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy Swiss-Prot
Match: O08547 (Vesicle-trafficking protein SEC22b OS=Mus musculus OX=10090 GN=Sec22b PE=1 SV=3) HSP 1 Score: 53.5 bits (127), Expect = 1.3e-06 Identity = 29/65 (44.62%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy Swiss-Prot
Match: Q5RAI9 (Vesicle-trafficking protein SEC22b OS=Pongo abelii OX=9601 GN=SEC22B PE=2 SV=3) HSP 1 Score: 53.5 bits (127), Expect = 1.3e-06 Identity = 29/65 (44.62%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy TrEMBL
Match: A0A0D3GDU4 (Uncharacterized protein OS=Oryza barthii OX=65489 PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 7.6e-26 Identity = 61/81 (75.31%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy TrEMBL
Match: A0A7J9K1U8 (Uncharacterized protein OS=Gossypium armourianum OX=34283 GN=Goarm_002989 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 1.0e-25 Identity = 60/73 (82.19%), Postives = 64/73 (87.67%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy TrEMBL
Match: A0A7J9F2B2 (Uncharacterized protein OS=Gossypium trilobum OX=34281 GN=Gotri_003565 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 1.0e-25 Identity = 60/73 (82.19%), Postives = 64/73 (87.67%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy TrEMBL
Match: A0A7J9HR89 (Uncharacterized protein OS=Gossypium harknessii OX=34285 GN=Gohar_026199 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 1.0e-25 Identity = 60/73 (82.19%), Postives = 64/73 (87.67%), Query Frame = 0
BLAST of HG10002425.1 vs. ExPASy TrEMBL
Match: A0A444X7K5 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_B10g105193 PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 2.2e-25 Identity = 61/65 (93.85%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of HG10002425.1 vs. TAIR 10
Match: AT1G11890.1 (Synaptobrevin family protein ) HSP 1 Score: 112.1 bits (279), Expect = 2.2e-25 Identity = 53/64 (82.81%), Postives = 59/64 (92.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|