CsaV3_1G044850.1 (mRNA) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTACAGGGAAAGACACAGTACTATCATGGAAATCAAGAGTACAGATTTTGAGAGACTGTGCACTTGCATTGAGATATCTTCATCAACGTGTTGATGGCTGCATTGTCCATAGAGATATTAAGGTAACATCTTACTCTCATCCTACTTTCTTTCTTTCTTTTTCTTTTCAAAATTGA ATGTTTACAGGGAAAGACACAGTACTATCATGGAAATCAAGAGTACAGATTTTGAGAGACTGTGCACTTGCATTGAGATATCTTCATCAACGTGTTGATGGCTGCATTGTCCATAGAGATATTAAGGTAACATCTTACTCTCATCCTACTTTCTTTCTTTCTTTTTCTTTTCAAAATTGA ATGTTTACAGGGAAAGACACAGTACTATCATGGAAATCAAGAGTACAGATTTTGAGAGACTGTGCACTTGCATTGAGATATCTTCATCAACGTGTTGATGGCTGCATTGTCCATAGAGATATTAAGGTAACATCTTACTCTCATCCTACTTTCTTTCTTTCTTTTTCTTTTCAAAATTGA MFTGKDTVLSWKSRVQILRDCALALRYLHQRVDGCIVHRDIKVTSYSHPTFFLSFSFQN* Homology
BLAST of CsaV3_1G044850.1 vs. NCBI nr
Match: KGN66710.1 (hypothetical protein Csa_006953 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 5.1e-26 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. NCBI nr
Match: XP_008444026.1 (PREDICTED: cysteine-rich receptor-like protein kinase 1 [Cucumis melo]) HSP 1 Score: 85.9 bits (211), Expect = 1.3e-13 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. NCBI nr
Match: KAA0038318.1 (cysteine-rich receptor-like protein kinase 1 [Cucumis melo var. makuwa]) HSP 1 Score: 85.9 bits (211), Expect = 1.3e-13 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. NCBI nr
Match: XP_031742672.1 (putative serine/threonine-protein kinase [Cucumis sativus]) HSP 1 Score: 85.9 bits (211), Expect = 1.3e-13 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. NCBI nr
Match: XP_022152108.1 (probable leucine-rich repeat receptor-like protein kinase At5g49770 [Momordica charantia]) HSP 1 Score: 78.2 bits (191), Expect = 2.7e-11 Identity = 35/41 (85.37%), Postives = 39/41 (95.12%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy Swiss-Prot
Match: Q9M3E5 (Putative L-type lectin-domain containing receptor kinase I.1 OS=Arabidopsis thaliana OX=3702 GN=LECRK11 PE=3 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 6.7e-05 Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy Swiss-Prot
Match: Q7FK82 (Probable L-type lectin-domain containing receptor kinase I.2 OS=Arabidopsis thaliana OX=3702 GN=LECRK12 PE=2 SV=2) HSP 1 Score: 46.6 bits (109), Expect = 1.2e-04 Identity = 21/45 (46.67%), Postives = 27/45 (60.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy Swiss-Prot
Match: O81069 (Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana OX=3702 GN=At2g28990 PE=1 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 4.4e-04 Identity = 21/38 (55.26%), Postives = 27/38 (71.05%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy Swiss-Prot
Match: Q9FJI4 (Putative L-type lectin-domain containing receptor kinase I.11 OS=Arabidopsis thaliana OX=3702 GN=LECRK111 PE=3 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 7.5e-04 Identity = 19/45 (42.22%), Postives = 28/45 (62.22%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy Swiss-Prot
Match: Q9M3D7 (Putative L-type lectin-domain containing receptor kinase I.4 OS=Arabidopsis thaliana OX=3702 GN=LECRK14 PE=3 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 7.5e-04 Identity = 18/45 (40.00%), Postives = 28/45 (62.22%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy TrEMBL
Match: A0A0A0LXX1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G662500 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 2.5e-26 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy TrEMBL
Match: A0A5A7T626 (Cysteine-rich receptor-like protein kinase 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold270G001880 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 6.3e-14 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy TrEMBL
Match: A0A1S3BA67 (cysteine-rich receptor-like protein kinase 1 OS=Cucumis melo OX=3656 GN=LOC103487474 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 6.3e-14 Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy TrEMBL
Match: A0A6J1DDZ1 (probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Momordica charantia OX=3673 GN=LOC111019897 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 1.3e-11 Identity = 35/41 (85.37%), Postives = 39/41 (95.12%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. ExPASy TrEMBL
Match: A0A6J1KSD4 (probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Cucurbita maxima OX=3661 GN=LOC111496822 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 3.8e-11 Identity = 33/41 (80.49%), Postives = 39/41 (95.12%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. TAIR 10
Match: AT3G45330.1 (Concanavalin A-like lectin protein kinase family protein ) HSP 1 Score: 47.4 bits (111), Expect = 4.8e-06 Identity = 22/45 (48.89%), Postives = 27/45 (60.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. TAIR 10
Match: AT3G59110.1 (Protein kinase superfamily protein ) HSP 1 Score: 47.0 bits (110), Expect = 6.3e-06 Identity = 19/42 (45.24%), Postives = 31/42 (73.81%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. TAIR 10
Match: AT2G28990.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 44.7 bits (104), Expect = 3.1e-05 Identity = 21/38 (55.26%), Postives = 27/38 (71.05%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. TAIR 10
Match: AT3G46400.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 44.3 bits (103), Expect = 4.1e-05 Identity = 20/40 (50.00%), Postives = 26/40 (65.00%), Query Frame = 0
BLAST of CsaV3_1G044850.1 vs. TAIR 10
Match: AT3G45420.1 (Concanavalin A-like lectin protein kinase family protein ) HSP 1 Score: 43.9 bits (102), Expect = 5.3e-05 Identity = 18/45 (40.00%), Postives = 28/45 (62.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
|