Cmc11g0290101.1 (mRNA) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCTCTAAGATCGACCTTCGGTCGGGATATCATCAGCTGAGGATTAAGGATAGCGATGTACCGAAGACAGCCTTTTGTTCCAGATATGGACACTATGAGTTTATTGTGATATCTTTTGGTTTGACGAATGCTCCGGCAATGTTCATGGATTTGATGAACAGAGTGTTTAGAGAGTTCCTAAACACTCTTGTGATCGTGTTTATTGATGATATTTTGATATATTCTAAGATAGAGGCCGAGCATGAGGAGCATTTACGCATGGTTCTAGAAACCCTTCGAGTTAATAAATTATAG ATGTTCTCTAAGATCGACCTTCGGTCGGGATATCATCAGCTGAGGATTAAGGATAGCGATGTACCGAAGACAGCCTTTTGTTCCAGATATGGACACTATGAGTTTATTGTGATATCTTTTGGTTTGACGAATGCTCCGGCAATGTTCATGGATTTGATGAACAGAGTGTTTAGAGAGTTCCTAAACACTCTTGTGATCGTGTTTATTGATGATATTTTGATATATTCTAAGATAGAGGCCGAGCATGAGGAGCATTTACGCATGGTTCTAGAAACCCTTCGAGTTAATAAATTATAG ATGTTCTCTAAGATCGACCTTCGGTCGGGATATCATCAGCTGAGGATTAAGGATAGCGATGTACCGAAGACAGCCTTTTGTTCCAGATATGGACACTATGAGTTTATTGTGATATCTTTTGGTTTGACGAATGCTCCGGCAATGTTCATGGATTTGATGAACAGAGTGTTTAGAGAGTTCCTAAACACTCTTGTGATCGTGTTTATTGATGATATTTTGATATATTCTAAGATAGAGGCCGAGCATGAGGAGCATTTACGCATGGTTCTAGAAACCCTTCGAGTTAATAAATTATAG MFSKIDLRSGYHQLRIKDSDVPKTAFCSRYGHYEFIVISFGLTNAPAMFMDLMNRVFREFLNTLVIVFIDDILIYSKIEAEHEEHLRMVLETLRVNKL Homology
BLAST of Cmc11g0290101.1 vs. NCBI nr
Match: KAA0032281.1 (ty3-gypsy retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 180.3 bits (456), Expect = 8.3e-42 Identity = 88/98 (89.80%), Postives = 93/98 (94.90%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. NCBI nr
Match: TYK13611.1 (ty3-gypsy retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 178.7 bits (452), Expect = 2.4e-41 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. NCBI nr
Match: KAA0067467.1 (pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 178.3 bits (451), Expect = 3.2e-41 Identity = 88/98 (89.80%), Postives = 93/98 (94.90%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. NCBI nr
Match: KAA0046049.1 (pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 178.3 bits (451), Expect = 3.2e-41 Identity = 89/98 (90.82%), Postives = 93/98 (94.90%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. NCBI nr
Match: TYK29834.1 (ty3-gypsy retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 178.3 bits (451), Expect = 3.2e-41 Identity = 88/98 (89.80%), Postives = 94/98 (95.92%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy Swiss-Prot
Match: P31843 (RNA-directed DNA polymerase homolog OS=Oenothera berteroana OX=3950 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.0e-19 Identity = 49/97 (50.52%), Postives = 67/97 (69.07%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy Swiss-Prot
Match: Q8I7P9 (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 3.9e-18 Identity = 41/92 (44.57%), Postives = 67/92 (72.83%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy Swiss-Prot
Match: P04323 (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.1e-16 Identity = 40/92 (43.48%), Postives = 59/92 (64.13%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy Swiss-Prot
Match: P20825 (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.2e-16 Identity = 38/92 (41.30%), Postives = 58/92 (63.04%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy Swiss-Prot
Match: P0CT41 (Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-12 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 6.9e-15 Identity = 37/94 (39.36%), Postives = 64/94 (68.09%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy TrEMBL
Match: A0A5A7SRV6 (Reverse transcriptase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold219G001230 PE=4 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 4.0e-42 Identity = 88/98 (89.80%), Postives = 93/98 (94.90%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy TrEMBL
Match: A0A5D3CP69 (Ty3-gypsy retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold299G001130 PE=4 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 1.2e-41 Identity = 87/89 (97.75%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy TrEMBL
Match: A0A5D3E1T8 (Ty3-gypsy retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold208G00660 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 1.5e-41 Identity = 88/98 (89.80%), Postives = 94/98 (95.92%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy TrEMBL
Match: A0A5A7TXS2 (Reverse transcriptase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold243G006230 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 1.5e-41 Identity = 89/98 (90.82%), Postives = 93/98 (94.90%), Query Frame = 0
BLAST of Cmc11g0290101.1 vs. ExPASy TrEMBL
Match: A0A5A7VJV1 (Pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold40G001400 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 1.5e-41 Identity = 88/98 (89.80%), Postives = 93/98 (94.90%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|