CmaCh06G001410.1 (mRNA) Cucurbita maxima (Rimu) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGAACAAAGCAAGAAACTCCAAAAGTCAGGCAGCCACTCCATCGTCAAAGATGCTTATCCCATTTTTATCCCATGAACAAAGCAAGAAACTCCAAACTTGTAAGTTCAAAGTTCATGAAATGGCTATAAATACTCTCCCCTCTAACCCATATTCAAACCCAAATCAAAGAACACCAAATCTAAGAGATCAAGATGTCTGAATGTCCTCCAGGTATGTGTTATTTTGTGCGCTTGATTTAGTTCTATCTTCTTCAAAGATTATGGAATAATTTTTTGTAATGTCCTAAATAAACGGTAGGAAAAGACCAATGGCCCGAGCTGGTTTTCGTAGAGTATTCTACTGCTGCACTGATCATTGAGAAGGAGAATCCTAACGTGAAAGCACACAAGATTCTAGCTGGGAGTCCGAGAATTTTGAACTTTGATTGTTCACGAGTTTGGGTTGATGTCAATATCAATGATGTTGTTGTTAAAGTGCCTGCGATTGGTTAAGGATTGTGAATTGATATCTATATGTAATACATACATATATTTCAAATTAATAATAAGGTAGTATCTTTCTACCACTTTCATTTCAATGATCTCTTGAGCAGGATCAAGTTAAAAGGGTAATACATACATACATTTGCGTTATCACCATGAGAAAACTTGAAATTGTGACTGAAAAACTAAGAACAAAAGATGAACAATATGACTATT TGAACAAAGCAAGAAACTCCAAAAGTCAGGCAGCCACTCCATCGTCAAAGATGCTTATCCCATTTTTATCCCATGAACAAAGCAAGAAACTCCAAACTTGTAAGTTCAAAGTTCATGAAATGGCTATAAATACTCTCCCCTCTAACCCATATTCAAACCCAAATCAAAGAACACCAAATCTAAGAGATCAAGATGTCTGAATGTCCTCCAGGAAAAGACCAATGGCCCGAGCTGGTTTTCGTAGAGTATTCTACTGCTGCACTGATCATTGAGAAGGAGAATCCTAACGTGAAAGCACACAAGATTCTAGCTGGGAGTCCGAGAATTTTGAACTTTGATTGTTCACGAGTTTGGGTTGATGTCAATATCAATGATGTTGTTGTTAAAGTGCCTGCGATTGGTTAAGGATTGTGAATTGATATCTATATGTAATACATACATATATTTCAAATTAATAATAAGGTAGTATCTTTCTACCACTTTCATTTCAATGATCTCTTGAGCAGGATCAAGTTAAAAGGGTAATACATACATACATTTGCGTTATCACCATGAGAAAACTTGAAATTGTGACTGAAAAACTAAGAACAAAAGATGAACAATATGACTATT ATGTCTGAATGTCCTCCAGGAAAAGACCAATGGCCCGAGCTGGTTTTCGTAGAGTATTCTACTGCTGCACTGATCATTGAGAAGGAGAATCCTAACGTGAAAGCACACAAGATTCTAGCTGGGAGTCCGAGAATTTTGAACTTTGATTGTTCACGAGTTTGGGTTGATGTCAATATCAATGATGTTGTTGTTAAAGTGCCTGCGATTGGTTAA MSECPPGKDQWPELVFVEYSTAALIIEKENPNVKAHKILAGSPRILNFDCSRVWVDVNINDVVVKVPAIG Homology
BLAST of CmaCh06G001410.1 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.8e-09 Identity = 34/69 (49.28%), Postives = 42/69 (60.87%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 9.0e-09 Identity = 31/64 (48.44%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy Swiss-Prot
Match: P80211 (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.4e-08 Identity = 32/67 (47.76%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy Swiss-Prot
Match: P24076 (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 9.9e-08 Identity = 30/69 (43.48%), Postives = 40/69 (57.97%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 2.2e-07 Identity = 33/69 (47.83%), Postives = 42/69 (60.87%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy TrEMBL
Match: A0A0A0L8E6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142910 PE=3 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 7.6e-19 Identity = 46/68 (67.65%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy TrEMBL
Match: A0A5A7U4U0 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001250 PE=3 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 2.9e-18 Identity = 48/63 (76.19%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy TrEMBL
Match: A0A5A7U4L9 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001240 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 6.4e-18 Identity = 47/65 (72.31%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy TrEMBL
Match: A0A5A7U228 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001230 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.1e-17 Identity = 43/64 (67.19%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. ExPASy TrEMBL
Match: A0A0A0L785 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G141900 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 1.6e-16 Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. NCBI nr
Match: KGN56897.1 (hypothetical protein Csa_010510 [Cucumis sativus]) HSP 1 Score: 102.4 bits (254), Expect = 1.6e-18 Identity = 46/68 (67.65%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. NCBI nr
Match: KAA0049286.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17272.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 100.5 bits (249), Expect = 6.0e-18 Identity = 48/63 (76.19%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. NCBI nr
Match: KAA0049287.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17271.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 99.4 bits (246), Expect = 1.3e-17 Identity = 47/65 (72.31%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. NCBI nr
Match: KAA0049288.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17270.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 98.6 bits (244), Expect = 2.3e-17 Identity = 43/64 (67.19%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. NCBI nr
Match: KAE8650337.1 (hypothetical protein Csa_010581 [Cucumis sativus]) HSP 1 Score: 91.3 bits (225), Expect = 3.6e-15 Identity = 44/61 (72.13%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 63.9 bits (154), Expect = 5.8e-11 Identity = 34/69 (49.28%), Postives = 42/69 (60.87%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 58.9 bits (141), Expect = 1.9e-09 Identity = 31/65 (47.69%), Postives = 41/65 (63.08%), Query Frame = 0
BLAST of CmaCh06G001410.1 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 55.1 bits (131), Expect = 2.7e-08 Identity = 31/68 (45.59%), Postives = 38/68 (55.88%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita maxima (Rimu) v1.1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|