Cla97C09G174460.1 (mRNA) Watermelon (97103) v2.5
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCCATCATACATGATTGAGTTGCGAAAACTTCTGGATAGGTATCCCACATCTGAACTGAATTCTTTCTGGTTAAAGAATCTCTTTCTAGTTGCTCTGGAACAATTAGGAGATTCTCTAGAAGAAATATGGGGTTCTGCTTCTGGTGGCAACATGCTATGGGGTGGCGGTCCCGCTTATGGGGTCAAATCAATACGTTCGAAGAAGAAAGATTGGAATATCAATCTCATCGATCTCATAAGTATCATACCAAATCCCATCAATCGAATCGCTTTTTCGAGAAATACGAGACATCTAAGTCATACAAGTAAAGAGATATATTCATTGATAAGTGGTGTCTTCAAATTTTCTCTTTAA ATGATTCCATCATACATGATTGAGTTGCGAAAACTTCTGGATAGGTATCCCACATCTGAACTGAATTCTTTCTGGTTAAAGAATCTCTTTCTAGTTGCTCTGGAACAATTAGGAGATTCTCTAGAAGAAATATGGGGTTCTGCTTCTGGTGGCAACATGCTATGGGGTGGCGGTCCCGCTTATGGGGTCAAATCAATACGTTCGAAGAAGAAAGATTGGAATATCAATCTCATCGATCTCATAAGTATCATACCAAATCCCATCAATCGAATCGCTTTTTCGAGAAATACGAGACATCTAAGTCATACAAGTAAAGAGATATATTCATTGATAAGTGGTGTCTTCAAATTTTCTCTTTAA ATGATTCCATCATACATGATTGAGTTGCGAAAACTTCTGGATAGGTATCCCACATCTGAACTGAATTCTTTCTGGTTAAAGAATCTCTTTCTAGTTGCTCTGGAACAATTAGGAGATTCTCTAGAAGAAATATGGGGTTCTGCTTCTGGTGGCAACATGCTATGGGGTGGCGGTCCCGCTTATGGGGTCAAATCAATACGTTCGAAGAAGAAAGATTGGAATATCAATCTCATCGATCTCATAAGTATCATACCAAATCCCATCAATCGAATCGCTTTTTCGAGAAATACGAGACATCTAAGTCATACAAGTAAAGAGATATATTCATTGATAAGTGGTGTCTTCAAATTTTCTCTTTAA MIPSYMIELRKLLDRYPTSELNSFWLKNLFLVALEQLGDSLEEIWGSASGGNMLWGGGPAYGVKSIRSKKKDWNINLIDLISIIPNPINRIAFSRNTRHLSHTSKEIYSLISGVFKFSL Homology
BLAST of Cla97C09G174460.1 vs. NCBI nr
Match: YP_009468904.1 (hypothetical chloroplast RF2 [Gynostemma compressum] >YP_009468924.1 hypothetical chloroplast RF2 [Gynostemma compressum] >AVA29805.1 hypothetical chloroplast RF2 [Gynostemma compressum] >AVA29806.1 hypothetical chloroplast RF2 [Gynostemma compressum]) HSP 1 Score: 227.3 bits (578), Expect = 7.2e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. NCBI nr
Match: YP_009752370.1 (Ycf2 protein [Bryonia marmorata] >YP_009752388.1 Ycf2 protein [Bryonia marmorata] >QIT04344.1 Ycf2 protein [Bryonia marmorata] >QIT04362.1 Ycf2 protein [Bryonia marmorata]) HSP 1 Score: 227.3 bits (578), Expect = 7.2e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. NCBI nr
Match: QJR53001.1 (hypothetical protein RF2 [Herpetospermum pedunculosum] >QJR53017.1 hypothetical protein RF2 [Herpetospermum pedunculosum]) HSP 1 Score: 227.3 bits (578), Expect = 7.2e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. NCBI nr
Match: YP_010131137.1 (hypothetical protein RF2 [Benincasa hispida] >YP_010131154.1 hypothetical protein RF2 [Benincasa hispida] >QPZ75785.1 hypothetical protein RF2 [Benincasa hispida] >QPZ75802.1 hypothetical protein RF2 [Benincasa hispida] >QSQ72354.1 Ycf2 protein [Benincasa hispida] >QSQ72372.1 Ycf2 protein [Benincasa hispida]) HSP 1 Score: 227.3 bits (578), Expect = 7.2e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. NCBI nr
Match: YP_009752033.1 (Ycf2 protein [Cionosicys macranthus] >YP_009752051.1 Ycf2 protein [Cionosicys macranthus] >QIT05274.1 Ycf2 protein [Cionosicys macranthus] >QIT05292.1 Ycf2 protein [Cionosicys macranthus]) HSP 1 Score: 227.3 bits (578), Expect = 7.2e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy Swiss-Prot
Match: B1NWJ3 (Protein Ycf2 OS=Manihot esculenta OX=3983 GN=ycf2 PE=3 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 1.4e-54 Identity = 106/111 (95.50%), Postives = 107/111 (96.40%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy Swiss-Prot
Match: A4GYV4 (Protein Ycf2 OS=Populus trichocarpa OX=3694 GN=ycf2-1 PE=3 SV=1) HSP 1 Score: 210.7 bits (535), Expect = 9.1e-54 Identity = 106/111 (95.50%), Postives = 107/111 (96.40%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy Swiss-Prot
Match: Q14F97 (Protein Ycf2 OS=Populus alba OX=43335 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 209.5 bits (532), Expect = 2.0e-53 Identity = 106/111 (95.50%), Postives = 106/111 (95.50%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy Swiss-Prot
Match: Q49KT6 (Protein Ycf2 OS=Eucalyptus globulus subsp. globulus OX=71271 GN=ycf2-A PE=3 SV=1) HSP 1 Score: 206.8 bits (525), Expect = 1.3e-52 Identity = 102/111 (91.89%), Postives = 106/111 (95.50%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy Swiss-Prot
Match: Q589A6 (Protein Ycf2 OS=Silene latifolia OX=37657 GN=ycf2 PE=3 SV=1) HSP 1 Score: 205.7 bits (522), Expect = 2.9e-52 Identity = 103/111 (92.79%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy TrEMBL
Match: A0A343F2F1 (Protein Ycf2 OS=Citrullus colocynthis OX=252529 GN=ycf2 PE=3 SV=1) HSP 1 Score: 227.3 bits (578), Expect = 3.5e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy TrEMBL
Match: A0A6H0ET42 (Protein Ycf2 OS=Trichosanthes kirilowii OX=3677 GN=ycf2 PE=3 SV=1) HSP 1 Score: 227.3 bits (578), Expect = 3.5e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy TrEMBL
Match: A0A6H0EV63 (Protein Ycf2 OS=Corallocarpus boehmii OX=386154 GN=ycf2 PE=3 SV=1) HSP 1 Score: 227.3 bits (578), Expect = 3.5e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy TrEMBL
Match: A0A6M3RUH1 (Protein Ycf2 OS=Trichosanthes rosthornii OX=676073 GN=ycf2 PE=3 SV=1) HSP 1 Score: 227.3 bits (578), Expect = 3.5e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. ExPASy TrEMBL
Match: A0A6H0ESM3 (Protein Ycf2 OS=Trichosanthes tubiflora OX=1144424 GN=ycf2 PE=3 SV=1) HSP 1 Score: 227.3 bits (578), Expect = 3.5e-56 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. TAIR 10
Match: ATCG00860.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 194.1 bits (492), Expect = 6.3e-50 Identity = 102/114 (89.47%), Postives = 103/114 (90.35%), Query Frame = 0
BLAST of Cla97C09G174460.1 vs. TAIR 10
Match: ATCG01280.1 (Chloroplast Ycf2;ATPase, AAA type, core ) HSP 1 Score: 194.1 bits (492), Expect = 6.3e-50 Identity = 102/114 (89.47%), Postives = 103/114 (90.35%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Watermelon (97103) v2.5
Date Performed: 2022-01-31
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|