
Chy2G033170.1 (mRNA) Cucumber (hystrix) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCATCCCTTAAATCTGACCCCGCCAGCCTCACCGCCGACACCAAAGGCCTCGCCGTCATCATGGCTTCCATCGGTGCTGCTAACGCCACCGCCACCGCGAGCTACCTCTCGTCTCAGCTCCCTACATCCTCCTCCGGTGCCGCTGCCGCCAACAACAACAAAACAAAATTGCTGAGACAATGCTCCGAGAAATACGCATTTGCAGCTGAAGCACTTAGAGAATCTTTGAAAGATTTAGCTGATGAGACTTATGACTATGCTTATATGCATGTTTCTGCGGCGGCGGATTATGCCAATGTTTGCCGTGATGCCTTTAAAGGGTTCCCGGCGGTGAGTTATCCGGCGAAGCTTGGCCGGAGAGAAGAAGGGTTGAAGCGTATTTGCAGAGTGGTTTTGGGGATTTTGGATCTTCTTGGCTGGTGATTTTCATCAATCATTATGTTCTCTCTCTAATCATATTTTTGTTTTTCTTTTTTTACTTTTACTTTTTGCTTTTACTTTTTTTTGGGGTAATAAACTTGTTTGTCTTTTTAGGTGA ATGTCATCCCTTAAATCTGACCCCGCCAGCCTCACCGCCGACACCAAAGGCCTCGCCGTCATCATGGCTTCCATCGGTGCTGCTAACGCCACCGCCACCGCGAGCTACCTCTCGTCTCAGCTCCCTACATCCTCCTCCGGTGCCGCTGCCGCCAACAACAACAAAACAAAATTGCTGAGACAATGCTCCGAGAAATACGCATTTGCAGCTGAAGCACTTAGAGAATCTTTGAAAGATTTAGCTGATGAGACTTATGACTATGCTTATATGCATGTTTCTGCGGCGGCGGATTATGCCAATGTTTGCCGTGATGCCTTTAAAGGGTTCCCGGCGGTGAGTTATCCGGCGAAGCTTGGCCGGAGAGAAGAAGGGTTGAAGCGTATTTGCAGAGTGGTTTTGGGGATTTTGGATCTTCTTGGCTGGTGA ATGTCATCCCTTAAATCTGACCCCGCCAGCCTCACCGCCGACACCAAAGGCCTCGCCGTCATCATGGCTTCCATCGGTGCTGCTAACGCCACCGCCACCGCGAGCTACCTCTCGTCTCAGCTCCCTACATCCTCCTCCGGTGCCGCTGCCGCCAACAACAACAAAACAAAATTGCTGAGACAATGCTCCGAGAAATACGCATTTGCAGCTGAAGCACTTAGAGAATCTTTGAAAGATTTAGCTGATGAGACTTATGACTATGCTTATATGCATGTTTCTGCGGCGGCGGATTATGCCAATGTTTGCCGTGATGCCTTTAAAGGGTTCCCGGCGGTGAGTTATCCGGCGAAGCTTGGCCGGAGAGAAGAAGGGTTGAAGCGTATTTGCAGAGTGGTTTTGGGGATTTTGGATCTTCTTGGCTGGTGA MSSLKSDPASLTADTKGLAVIMASIGAANATATASYLSSQLPTSSSGAAAANNNKTKLLRQCSEKYAFAAEALRESLKDLADETYDYAYMHVSAAADYANVCRDAFKGFPAVSYPAKLGRREEGLKRICRVVLGILDLLGW* Homology
BLAST of Chy2G033170.1 vs. ExPASy Swiss-Prot
Match: O49603 (Cell wall / vacuolar inhibitor of fructosidase 2 OS=Arabidopsis thaliana OX=3702 GN=C/VIF2 PE=1 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 9.9e-31 Identity = 74/139 (53.24%), Postives = 96/139 (69.06%), Query Frame = 0
BLAST of Chy2G033170.1 vs. ExPASy Swiss-Prot
Match: Q0J8J8 (Pectinesterase inhibitor 28 OS=Oryza sativa subsp. japonica OX=39947 GN=PMEI28 PE=2 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 4.3e-18 Identity = 57/141 (40.43%), Postives = 85/141 (60.28%), Query Frame = 0
BLAST of Chy2G033170.1 vs. ExPASy TrEMBL
Match: A0A5D3DQ82 (Cell wall / vacuolar inhibitor of fructosidase 2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1230G00230 PE=4 SV=1) HSP 1 Score: 256.9 bits (655), Expect = 4.9e-65 Identity = 134/141 (95.04%), Postives = 138/141 (97.87%), Query Frame = 0
BLAST of Chy2G033170.1 vs. ExPASy TrEMBL
Match: A0A1S3B228 (cell wall / vacuolar inhibitor of fructosidase 2 OS=Cucumis melo OX=3656 GN=LOC103485273 PE=4 SV=1) HSP 1 Score: 256.9 bits (655), Expect = 4.9e-65 Identity = 134/141 (95.04%), Postives = 138/141 (97.87%), Query Frame = 0
BLAST of Chy2G033170.1 vs. ExPASy TrEMBL
Match: A0A0A0KJ03 (PMEI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G483430 PE=4 SV=1) HSP 1 Score: 255.0 bits (650), Expect = 1.9e-64 Identity = 136/141 (96.45%), Postives = 137/141 (97.16%), Query Frame = 0
BLAST of Chy2G033170.1 vs. ExPASy TrEMBL
Match: A0A6J1KU64 (cell wall / vacuolar inhibitor of fructosidase 2-like OS=Cucurbita maxima OX=3661 GN=LOC111497231 PE=4 SV=1) HSP 1 Score: 232.3 bits (591), Expect = 1.3e-57 Identity = 121/141 (85.82%), Postives = 129/141 (91.49%), Query Frame = 0
BLAST of Chy2G033170.1 vs. ExPASy TrEMBL
Match: A0A6J1HHS2 (cell wall / vacuolar inhibitor of fructosidase 2-like OS=Cucurbita moschata OX=3662 GN=LOC111463098 PE=4 SV=1) HSP 1 Score: 231.5 bits (589), Expect = 2.2e-57 Identity = 121/141 (85.82%), Postives = 128/141 (90.78%), Query Frame = 0
BLAST of Chy2G033170.1 vs. NCBI nr
Match: KAA0025533.1 (cell wall / vacuolar inhibitor of fructosidase 2 [Cucumis melo var. makuwa] >TYK25692.1 cell wall / vacuolar inhibitor of fructosidase 2 [Cucumis melo var. makuwa]) HSP 1 Score: 256 bits (655), Expect = 1.17e-85 Identity = 134/141 (95.04%), Postives = 138/141 (97.87%), Query Frame = 0
BLAST of Chy2G033170.1 vs. NCBI nr
Match: XP_008441045.1 (PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2 [Cucumis melo]) HSP 1 Score: 256 bits (655), Expect = 5.94e-85 Identity = 134/141 (95.04%), Postives = 138/141 (97.87%), Query Frame = 0
BLAST of Chy2G033170.1 vs. NCBI nr
Match: XP_004148650.1 (cell wall / vacuolar inhibitor of fructosidase 2 [Cucumis sativus] >KGN48362.1 hypothetical protein Csa_003804 [Cucumis sativus]) HSP 1 Score: 254 bits (650), Expect = 3.43e-84 Identity = 136/141 (96.45%), Postives = 137/141 (97.16%), Query Frame = 0
BLAST of Chy2G033170.1 vs. NCBI nr
Match: XP_038882809.1 (cell wall / vacuolar inhibitor of fructosidase 2 [Benincasa hispida]) HSP 1 Score: 240 bits (612), Expect = 2.03e-78 Identity = 127/141 (90.07%), Postives = 132/141 (93.62%), Query Frame = 0
BLAST of Chy2G033170.1 vs. NCBI nr
Match: XP_023003734.1 (cell wall / vacuolar inhibitor of fructosidase 2-like [Cucurbita maxima]) HSP 1 Score: 232 bits (591), Expect = 3.00e-75 Identity = 121/141 (85.82%), Postives = 129/141 (91.49%), Query Frame = 0
BLAST of Chy2G033170.1 vs. TAIR 10
Match: AT5G64620.1 (cell wall / vacuolar inhibitor of fructosidase 2 ) HSP 1 Score: 134.4 bits (337), Expect = 7.1e-32 Identity = 74/139 (53.24%), Postives = 96/139 (69.06%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (hystrix) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|