Bhi05M000943 (mRNA) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GGGATTTCATTGAAAGAGGAGCTGTGGAGAAGGCAATAAGAAGAGTTATAAAGGGAGAAGACATAGAGGATATGAGAAAAAAAGCTAAGGAATTGGCAAAGATGGAGAAGAAAGCTGTTGTAGAAAATGGATCTTCATATTTTGAATTGAAAGCTTTGATTAAGGAATTGGAATCATTAGCGTTTTGA GGGATTTCATTGAAAGAGGAGCTGTGGAGAAGGCAATAAGAAGAGTTATAAAGGGAGAAGACATAGAGGATATGAGAAAAAAAGCTAAGGAATTGGCAAAGATGGAGAAGAAAGCTGTTGTAGAAAATGGATCTTCATATTTTGAATTGAAAGCTTTGATTAAGGAATTGGAATCATTAGCGTTTTGA GGGATTTCATTGAAAGAGGAGCTGTGGAGAAGGCAATAAGAAGAGTTATAAAGGGAGAAGACATAGAGGATATGAGAAAAAAAGCTAAGGAATTGGCAAAGATGGAGAAGAAAGCTGTTGTAGAAAATGGATCTTCATATTTTGAATTGAAAGCTTTGATTAAGGAATTGGAATCATTAGCGTTTTGA DFIERGAVEKAIRRVIKGEDIEDMRKKAKELAKMEKKAVVENGSSYFELKALIKELESLAF Homology
BLAST of Bhi05M000943 vs. TAIR 10
Match: AT4G34135.1 (UDP-glucosyltransferase 73B2 ) HSP 1 Score: 52.8 bits (125), Expect = 1.2e-07 Identity = 28/58 (48.28%), Postives = 40/58 (68.97%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR 10
Match: AT2G15490.2 (UDP-glycosyltransferase 73B4 ) HSP 1 Score: 49.3 bits (116), Expect = 1.3e-06 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR 10
Match: AT2G15490.1 (UDP-glycosyltransferase 73B4 ) HSP 1 Score: 49.3 bits (116), Expect = 1.3e-06 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR 10
Match: AT2G15490.3 (UDP-glycosyltransferase 73B4 ) HSP 1 Score: 49.3 bits (116), Expect = 1.3e-06 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of Bhi05M000943 vs. TAIR 10
Match: AT4G34131.1 (UDP-glucosyl transferase 73B3 ) HSP 1 Score: 49.3 bits (116), Expect = 1.3e-06 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy Swiss-Prot
Match: Q94C57 (UDP-glucosyl transferase 73B2 OS=Arabidopsis thaliana OX=3702 GN=UGT73B2 PE=1 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.6e-06 Identity = 28/58 (48.28%), Postives = 40/58 (68.97%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy Swiss-Prot
Match: Q8W491 (UDP-glycosyltransferase 73B3 OS=Arabidopsis thaliana OX=3702 GN=UGT73B3 PE=2 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.8e-05 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy Swiss-Prot
Match: Q7Y232 (UDP-glycosyltransferase 73B4 OS=Arabidopsis thaliana OX=3702 GN=UGT73B4 PE=2 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.8e-05 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy Swiss-Prot
Match: Q2V6J9 (UDP-glucose flavonoid 3-O-glucosyltransferase 7 OS=Fragaria ananassa OX=3747 GN=GT7 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.8e-05 Identity = 24/59 (40.68%), Postives = 40/59 (67.80%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy Swiss-Prot
Match: Q8VZE9 (UDP-glycosyltransferase 73B1 OS=Arabidopsis thaliana OX=3702 GN=UGT73B1 PE=2 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 5.3e-05 Identity = 30/56 (53.57%), Postives = 38/56 (67.86%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy TrEMBL
Match: A0A6J1I4P1 (Glycosyltransferase OS=Cucurbita maxima OX=3661 GN=LOC111470961 PE=3 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 5.4e-13 Identity = 43/61 (70.49%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy TrEMBL
Match: A0A5D3C661 (Glycosyltransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G00650 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 4.6e-12 Identity = 42/61 (68.85%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy TrEMBL
Match: A0A1S4E0C3 (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC103495250 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 4.6e-12 Identity = 42/61 (68.85%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy TrEMBL
Match: A0A6J1I5V1 (Glycosyltransferase OS=Cucurbita maxima OX=3661 GN=LOC111470960 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 1.0e-11 Identity = 42/61 (68.85%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of Bhi05M000943 vs. ExPASy TrEMBL
Match: A0A1S4E112 (Glycosyltransferase OS=Cucumis melo OX=3656 GN=LOC107991336 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.7e-11 Identity = 40/60 (66.67%), Postives = 51/60 (85.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|