Bhi04M001721 (mRNA) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGAATTCAACTACGACAAAAGAATTCACAACGTGGTGGCAGTGGATGAAATAAGTTATAGAAACTGCACGGCTCCAAGAGGTTCCAAAGTGTTCAATTCTGGCAACGATGAGATCAAGCTCTCAATAGGATACAATTTCTTCATATGCACCTTACCAGCACACTGCCAAGCTGGGATGAAGATTGTTGTTGCTGCCCGCGCCCCCTAA ATGGTAGAATTCAACTACGACAAAAGAATTCACAACGTGGTGGCAGTGGATGAAATAAGTTATAGAAACTGCACGGCTCCAAGAGGTTCCAAAGTGTTCAATTCTGGCAACGATGAGATCAAGCTCTCAATAGGATACAATTTCTTCATATGCACCTTACCAGCACACTGCCAAGCTGGGATGAAGATTGTTGTTGCTGCCCGCGCCCCCTAA ATGGTAGAATTCAACTACGACAAAAGAATTCACAACGTGGTGGCAGTGGATGAAATAAGTTATAGAAACTGCACGGCTCCAAGAGGTTCCAAAGTGTTCAATTCTGGCAACGATGAGATCAAGCTCTCAATAGGATACAATTTCTTCATATGCACCTTACCAGCACACTGCCAAGCTGGGATGAAGATTGTTGTTGCTGCCCGCGCCCCCTAA MVEFNYDKRIHNVVAVDEISYRNCTAPRGSKVFNSGNDEIKLSIGYNFFICTLPAHCQAGMKIVVAARAP Homology
BLAST of Bhi04M001721 vs. TAIR 10
Match: AT2G02850.1 (plantacyanin ) HSP 1 Score: 84.0 bits (206), Expect = 5.4e-17 Identity = 37/64 (57.81%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Bhi04M001721 vs. TAIR 10
Match: AT1G17800.1 (early nodulin-like protein 22 ) HSP 1 Score: 62.0 bits (149), Expect = 2.2e-10 Identity = 28/71 (39.44%), Postives = 45/71 (63.38%), Query Frame = 0
BLAST of Bhi04M001721 vs. TAIR 10
Match: AT5G26330.1 (Cupredoxin superfamily protein ) HSP 1 Score: 59.3 bits (142), Expect = 1.4e-09 Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 0
BLAST of Bhi04M001721 vs. TAIR 10
Match: AT2G32300.1 (uclacyanin 1 ) HSP 1 Score: 49.3 bits (116), Expect = 1.5e-06 Identity = 23/63 (36.51%), Postives = 35/63 (55.56%), Query Frame = 0
BLAST of Bhi04M001721 vs. TAIR 10
Match: AT3G60270.1 (Cupredoxin superfamily protein ) HSP 1 Score: 48.5 bits (114), Expect = 2.5e-06 Identity = 24/69 (34.78%), Postives = 37/69 (53.62%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy Swiss-Prot
Match: Q8LG89 (Basic blue protein OS=Arabidopsis thaliana OX=3702 GN=ARPN PE=2 SV=2) HSP 1 Score: 84.0 bits (206), Expect = 7.6e-16 Identity = 37/64 (57.81%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy Swiss-Prot
Match: P60496 (Chemocyanin OS=Lilium longiflorum OX=4690 PE=1 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 3.8e-15 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy Swiss-Prot
Match: P00303 (Basic blue protein OS=Cucumis sativus OX=3659 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.4e-14 Identity = 33/64 (51.56%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy Swiss-Prot
Match: P00302 (Stellacyanin OS=Toxicodendron vernicifluum OX=4013 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 5.8e-08 Identity = 22/61 (36.07%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy Swiss-Prot
Match: P80728 (Mavicyanin OS=Cucurbita pepo OX=3663 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 9.9e-08 Identity = 23/63 (36.51%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy TrEMBL
Match: A0A6J1J2F7 (basic blue protein-like OS=Cucurbita maxima OX=3661 GN=LOC111480707 PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.2e-19 Identity = 46/65 (70.77%), Postives = 53/65 (81.54%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy TrEMBL
Match: A0A6J1DI73 (basic blue protein-like OS=Momordica charantia OX=3673 GN=LOC111021165 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 1.5e-19 Identity = 46/67 (68.66%), Postives = 53/67 (79.10%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy TrEMBL
Match: A0A6J1FMC7 (basic blue protein-like OS=Cucurbita moschata OX=3662 GN=LOC111446527 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 7.6e-19 Identity = 45/65 (69.23%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy TrEMBL
Match: A0A6J1FSU5 (basic blue protein-like OS=Cucurbita moschata OX=3662 GN=LOC111446556 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 7.6e-19 Identity = 45/65 (69.23%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of Bhi04M001721 vs. ExPASy TrEMBL
Match: A0A6J1FK99 (basic blue protein-like OS=Cucurbita moschata OX=3662 GN=LOC111446518 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 7.6e-19 Identity = 45/65 (69.23%), Postives = 52/65 (80.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|