
Tan0017007 (gene) Snake gourd v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAATGAAGAAGTTTGCCTGTGCCACCCTCTTTGCTGCTGTTGCAGTCAGCACAGTCGTGGCCTCCAATGAGTCTCTCTCTCCTGCCGCCGCACCCGGGCCGAGTAGTGCCGCCTCTGTCGCTCTTCCCGCCCTTGGATCGCTAATTGGTGCCTCACTTGTTTCCTTCCTTACCTACATCTTGAATTGA ATGAAAATGAAGAAGTTTGCCTGTGCCACCCTCTTTGCTGCTGTTGCAGTCAGCACAGTCGTGGCCTCCAATGAGTCTCTCTCTCCTGCCGCCGCACCCGGGCCGAGTAGTGCCGCCTCTGTCGCTCTTCCCGCCCTTGGATCGCTAATTGGTGCCTCACTTGTTTCCTTCCTTACCTACATCTTGAATTGA ATGAAAATGAAGAAGTTTGCCTGTGCCACCCTCTTTGCTGCTGTTGCAGTCAGCACAGTCGTGGCCTCCAATGAGTCTCTCTCTCCTGCCGCCGCACCCGGGCCGAGTAGTGCCGCCTCTGTCGCTCTTCCCGCCCTTGGATCGCTAATTGGTGCCTCACTTGTTTCCTTCCTTACCTACATCTTGAATTGA MKMKKFACATLFAAVAVSTVVASNESLSPAAAPGPSSAASVALPALGSLIGASLVSFLTYILN Homology
BLAST of Tan0017007 vs. ExPASy Swiss-Prot
Match: Q8S2W4 (Arabinogalactan protein 23 OS=Arabidopsis thaliana OX=3702 GN=AGP23 PE=1 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-09 Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 0
BLAST of Tan0017007 vs. NCBI nr
Match: XP_023528634.1 (arabinogalactan peptide 23 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 87.8 bits (216), Expect = 3.6e-14 Identity = 51/63 (80.95%), Postives = 56/63 (88.89%), Query Frame = 0
BLAST of Tan0017007 vs. NCBI nr
Match: XP_038899473.1 (arabinogalactan protein 23-like [Benincasa hispida]) HSP 1 Score: 85.9 bits (211), Expect = 1.4e-13 Identity = 49/63 (77.78%), Postives = 56/63 (88.89%), Query Frame = 0
BLAST of Tan0017007 vs. NCBI nr
Match: KAG7018419.1 (Arabinogalactan peptide 23, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 85.1 bits (209), Expect = 2.3e-13 Identity = 50/63 (79.37%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Tan0017007 vs. NCBI nr
Match: XP_023004714.1 (arabinogalactan peptide 23-like [Cucurbita maxima]) HSP 1 Score: 84.7 bits (208), Expect = 3.1e-13 Identity = 49/63 (77.78%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Tan0017007 vs. NCBI nr
Match: KAG7025661.1 (Arabinogalactan peptide 23, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 83.2 bits (204), Expect = 8.9e-13 Identity = 48/63 (76.19%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Tan0017007 vs. ExPASy TrEMBL
Match: A0A6J1KX42 (arabinogalactan peptide 23-like OS=Cucurbita maxima OX=3661 GN=LOC111497929 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.5e-13 Identity = 49/63 (77.78%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Tan0017007 vs. ExPASy TrEMBL
Match: A0A6J1IYE9 (arabinogalactan peptide 23-like OS=Cucurbita maxima OX=3661 GN=LOC111479619 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 9.6e-13 Identity = 48/63 (76.19%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of Tan0017007 vs. ExPASy TrEMBL
Match: A0A6J1H8I1 (arabinogalactan peptide 23-like OS=Cucurbita moschata OX=3662 GN=LOC111461032 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 9.6e-13 Identity = 47/63 (74.60%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Tan0017007 vs. ExPASy TrEMBL
Match: A0A6J1F3F5 (arabinogalactan peptide 23-like OS=Cucurbita moschata OX=3662 GN=LOC111439670 PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 2.1e-12 Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 0
BLAST of Tan0017007 vs. ExPASy TrEMBL
Match: A0A1S3CDX5 (arabinogalactan peptide 23-like OS=Cucumis melo OX=3656 GN=LOC103499912 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 3.2e-08 Identity = 44/64 (68.75%), Postives = 50/64 (78.12%), Query Frame = 0
BLAST of Tan0017007 vs. TAIR 10
Match: AT3G57690.1 (arabinogalactan protein 23 ) HSP 1 Score: 62.4 bits (150), Expect = 1.5e-10 Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 0
BLAST of Tan0017007 vs. TAIR 10
Match: AT2G41905.1 (BEST Arabidopsis thaliana protein match is: arabinogalactan protein 23 (TAIR:AT3G57690.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 53.9 bits (128), Expect = 5.4e-08 Identity = 36/64 (56.25%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Tan0017007 vs. TAIR 10
Match: AT3G20865.1 (arabinogalactan protein 40 ) HSP 1 Score: 40.4 bits (93), Expect = 6.2e-04 Identity = 29/62 (46.77%), Postives = 41/62 (66.13%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Snake gourd (anguina) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|