Tan0008339 (gene) Snake gourd v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGAATCTAAGCCAGCCCTTGATGCGAGCCTAGCAACACAGCTGAAGTTGCAAGACGAGAAATTATATTGTTTGCCATTGATAATTAAACACAAAGCTTGTGTCACCAAGATTGTTACATTCTTCCTACCCGGTACGACCGACTTAGGTATCAACCATTGCCACACAATAATTAAGATTATTCAACACGAGTGTTGTCGAATATTGCTAATCTCTTTGGGAATTCCCGCAAAGGAATGCAACATTCTTGAGGCCTATTGTACTACTAGATCTATTAAGGTACACGGGTTTGTCTCGTTGGGAAGAAAAATGATCTTCGCAATATAG ATGGAAGAATCTAAGCCAGCCCTTGATGCGAGCCTAGCAACACAGCTGAAGTTGCAAGACGAGAAATTATATTGTTTGCCATTGATAATTAAACACAAAGCTTGTGTCACCAAGATTGTTACATTCTTCCTACCCGGTACGACCGACTTAGGTATCAACCATTGCCACACAATAATTAAGATTATTCAACACGAGTGTTGTCGAATATTGCTAATCTCTTTGGGAATTCCCGCAAAGGAATGCAACATTCTTGAGGCCTATTGTACTACTAGATCTATTAAGGTACACGGGTTTGTCTCGTTGGGAAGAAAAATGATCTTCGCAATATAG ATGGAAGAATCTAAGCCAGCCCTTGATGCGAGCCTAGCAACACAGCTGAAGTTGCAAGACGAGAAATTATATTGTTTGCCATTGATAATTAAACACAAAGCTTGTGTCACCAAGATTGTTACATTCTTCCTACCCGGTACGACCGACTTAGGTATCAACCATTGCCACACAATAATTAAGATTATTCAACACGAGTGTTGTCGAATATTGCTAATCTCTTTGGGAATTCCCGCAAAGGAATGCAACATTCTTGAGGCCTATTGTACTACTAGATCTATTAAGGTACACGGGTTTGTCTCGTTGGGAAGAAAAATGATCTTCGCAATATAG MEESKPALDASLATQLKLQDEKLYCLPLIIKHKACVTKIVTFFLPGTTDLGINHCHTIIKIIQHECCRILLISLGIPAKECNILEAYCTTRSIKVHGFVSLGRKMIFAI Homology
BLAST of Tan0008339 vs. ExPASy Swiss-Prot
Match: Q9SJ24 (Egg cell-secreted protein 1.2 OS=Arabidopsis thaliana OX=3702 GN=EC1.2 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.9e-05 Identity = 23/64 (35.94%), Postives = 37/64 (57.81%), Query Frame = 0
BLAST of Tan0008339 vs. ExPASy Swiss-Prot
Match: Q9T039 (Egg cell-secreted protein 1.4 OS=Arabidopsis thaliana OX=3702 GN=EC1.4 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 2.5e-05 Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 0
BLAST of Tan0008339 vs. ExPASy Swiss-Prot
Match: Q9SJ23 (Egg cell-secreted protein 1.3 OS=Arabidopsis thaliana OX=3702 GN=EC1.3 PE=2 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 5.5e-05 Identity = 23/66 (34.85%), Postives = 36/66 (54.55%), Query Frame = 0
BLAST of Tan0008339 vs. NCBI nr
Match: XP_023524588.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 84.0 bits (206), Expect = 9.0e-13 Identity = 47/91 (51.65%), Postives = 59/91 (64.84%), Query Frame = 0
BLAST of Tan0008339 vs. NCBI nr
Match: XP_022998659.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 80.1 bits (196), Expect = 1.3e-11 Identity = 46/91 (50.55%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of Tan0008339 vs. NCBI nr
Match: XP_023524587.1 (egg cell-secreted protein 1.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 79.3 bits (194), Expect = 2.2e-11 Identity = 45/91 (49.45%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of Tan0008339 vs. NCBI nr
Match: XP_022998660.1 (egg cell-secreted protein 1.1-like [Cucurbita maxima]) HSP 1 Score: 79.3 bits (194), Expect = 2.2e-11 Identity = 45/91 (49.45%), Postives = 57/91 (62.64%), Query Frame = 0
BLAST of Tan0008339 vs. NCBI nr
Match: KAA0035199.1 (egg cell-secreted protein 1.2-like [Cucumis melo var. makuwa] >TYK21814.1 egg cell-secreted protein 1.2-like [Cucumis melo var. makuwa]) HSP 1 Score: 79.0 bits (193), Expect = 2.9e-11 Identity = 45/90 (50.00%), Postives = 55/90 (61.11%), Query Frame = 0
BLAST of Tan0008339 vs. ExPASy TrEMBL
Match: A0A6J1KEX2 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493240 PE=4 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 6.3e-12 Identity = 46/91 (50.55%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of Tan0008339 vs. ExPASy TrEMBL
Match: A0A0A0LVH9 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124010 PE=4 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 6.3e-12 Identity = 45/90 (50.00%), Postives = 56/90 (62.22%), Query Frame = 0
BLAST of Tan0008339 vs. ExPASy TrEMBL
Match: A0A6J1KD37 (egg cell-secreted protein 1.1-like OS=Cucurbita maxima OX=3661 GN=LOC111493241 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.1e-11 Identity = 45/91 (49.45%), Postives = 57/91 (62.64%), Query Frame = 0
BLAST of Tan0008339 vs. ExPASy TrEMBL
Match: A0A5D3DE13 (Egg cell-secreted protein 1.2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold991G00290 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 1.4e-11 Identity = 45/90 (50.00%), Postives = 55/90 (61.11%), Query Frame = 0
BLAST of Tan0008339 vs. ExPASy TrEMBL
Match: A0A0A0LSR4 (Prolamin_like domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G124020 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.0e-09 Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 0
BLAST of Tan0008339 vs. TAIR 10
Match: AT2G21740.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 50.1 bits (118), Expect = 1.3e-06 Identity = 23/64 (35.94%), Postives = 37/64 (57.81%), Query Frame = 0
BLAST of Tan0008339 vs. TAIR 10
Match: AT4G39340.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 49.7 bits (117), Expect = 1.8e-06 Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 0
BLAST of Tan0008339 vs. TAIR 10
Match: AT2G21750.1 (Protein of unknown function (DUF1278) ) HSP 1 Score: 48.5 bits (114), Expect = 3.9e-06 Identity = 23/66 (34.85%), Postives = 36/66 (54.55%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Snake gourd (anguina) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|