Spg039439 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AATTATTTGCCAAAAAGGGCTGGATTGCAAAAGCAAAATTGTTTTACCTGTAATCTACCATATATGGATGGAAAAGGTTTCTTGTCTTTCATCTTCGTCTCACTCACAAGTCACACTTCTTGACACACACCACCGGTTCCTCCTTGTGTTCCTCCGGGAGAATTCCGCCATGGACGCCGCCGCCGCTTCCAACCGCCGTGTAGGGGTTGTTCTGTGTGTTGTTATTGCATTGAGCGGCGTCGTTTTGTGTGGTGCTGAGCTTCAGCGATTTGCCCATCCGCCAAAAGACGACGGCTCTCTCAGCCTTCTGGTCATCGGAGACTGGGGACGAAGAGGAGCTTTCAACCAATCTCAAGTTGCACTTCAGGTCCTCTCTCTCTCTCTCCCCTACAATTAATCTATGTTGTAGTTTTTTTAACTTTAAACACGCTATTAAATTACAGAATTTAACTGTTCTAAAGAGATTATTGATTCTTTCCCAAAAAAAAAAAAAAAAAAAAAAAAAAGAATGAGATTATTGATATCTTCTTCCTTCTTCTTTTCTCTCTGAGTTCAGATTGTTGATATCTTACGGTTAGTAATTACGATTTTTTAATCAATTTCATGAGTTTTTTTTTTCCCTTTTTAATTTTTTAATATTTGAATTCTGGGTCAGATTTCGAATGGATGA ATGGAAAAGGTTTCTTGTCTTTCATCTTCGTCTCACTCACAAGTCACACTTCTTGACACACACCACCGGTTCCTCCTTGTGTTCCTCCGGGAGAATTCCGCCATGGACGCCGCCGCCGCTTCCAACCGCCGTGTAGGGGTTGTTCTGTGTGTTGTTATTGCATTGAGCGGCGTCGTTTTGTGTGGTGCTGAGCTTCAGCGATTTGCCCATCCGCCAAAAGACGACGGCTCTCTCAGCCTTCTGGTCATCGGAGACTGGGGACGAAGAGGAGCTTTCAACCAATCTCAAGTTGCACTTCAGATTTCGAATGGATGA ATGGAAAAGGTTTCTTGTCTTTCATCTTCGTCTCACTCACAAGTCACACTTCTTGACACACACCACCGGTTCCTCCTTGTGTTCCTCCGGGAGAATTCCGCCATGGACGCCGCCGCCGCTTCCAACCGCCGTGTAGGGGTTGTTCTGTGTGTTGTTATTGCATTGAGCGGCGTCGTTTTGTGTGGTGCTGAGCTTCAGCGATTTGCCCATCCGCCAAAAGACGACGGCTCTCTCAGCCTTCTGGTCATCGGAGACTGGGGACGAAGAGGAGCTTTCAACCAATCTCAAGTTGCACTTCAGATTTCGAATGGATGA MEKVSCLSSSSHSQVTLLDTHHRFLLVFLRENSAMDAAAASNRRVGVVLCVVIALSGVVLCGAELQRFAHPPKDDGSLSLLVIGDWGRRGAFNQSQVALQISNG Homology
BLAST of Spg039439 vs. NCBI nr
Match: XP_023550610.1 (purple acid phosphatase 17-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 112.1 bits (279), Expect = 2.9e-21 Identity = 59/84 (70.24%), Postives = 70/84 (83.33%), Query Frame = 0
BLAST of Spg039439 vs. NCBI nr
Match: XP_022939885.1 (purple acid phosphatase 3-like [Cucurbita moschata]) HSP 1 Score: 102.4 bits (254), Expect = 2.3e-18 Identity = 48/64 (75.00%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Spg039439 vs. NCBI nr
Match: KAG6579177.1 (Purple acid phosphatase 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 101.7 bits (252), Expect = 4.0e-18 Identity = 47/64 (73.44%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Spg039439 vs. NCBI nr
Match: KAG7016693.1 (Purple acid phosphatase 3 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 101.7 bits (252), Expect = 4.0e-18 Identity = 47/64 (73.44%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Spg039439 vs. NCBI nr
Match: XP_022994036.1 (purple acid phosphatase 3-like [Cucurbita maxima]) HSP 1 Score: 101.3 bits (251), Expect = 5.2e-18 Identity = 48/64 (75.00%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy Swiss-Prot
Match: Q8VYZ2 (Purple acid phosphatase 8 OS=Arabidopsis thaliana OX=3702 GN=PAP8 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.6e-12 Identity = 35/56 (62.50%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy Swiss-Prot
Match: Q9SCX8 (Purple acid phosphatase 17 OS=Arabidopsis thaliana OX=3702 GN=PAP17 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 6.4e-11 Identity = 33/70 (47.14%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy Swiss-Prot
Match: Q8H129 (Purple acid phosphatase 3 OS=Arabidopsis thaliana OX=3702 GN=PAP3 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.1e-10 Identity = 37/80 (46.25%), Postives = 50/80 (62.50%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy Swiss-Prot
Match: Q8VYU7 (Purple acid phosphatase 4 OS=Arabidopsis thaliana OX=3702 GN=PAP4 PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 6.6e-08 Identity = 30/57 (52.63%), Postives = 35/57 (61.40%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy Swiss-Prot
Match: Q8S341 (Purple acid phosphatase 7 OS=Arabidopsis thaliana OX=3702 GN=PAP7 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.5e-07 Identity = 26/41 (63.41%), Postives = 31/41 (75.61%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy TrEMBL
Match: A0A6J1FP06 (Purple acid phosphatase OS=Cucurbita moschata OX=3662 GN=LOC111445616 PE=3 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 1.1e-18 Identity = 48/64 (75.00%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy TrEMBL
Match: A0A6J1JY06 (Purple acid phosphatase OS=Cucurbita maxima OX=3661 GN=LOC111489845 PE=3 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 2.5e-18 Identity = 48/64 (75.00%), Postives = 56/64 (87.50%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy TrEMBL
Match: A0A0A0KP97 (Purple acid phosphatase OS=Cucumis sativus OX=3659 GN=Csa_5G548110 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 6.9e-16 Identity = 45/65 (69.23%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy TrEMBL
Match: A0A6J1CX05 (Purple acid phosphatase OS=Momordica charantia OX=3673 GN=LOC111015567 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 2.0e-15 Identity = 46/67 (68.66%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Spg039439 vs. ExPASy TrEMBL
Match: A0A1S4E6U0 (Acid phosphatase OS=Cucumis melo OX=3656 GN=LOC103483030 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 3.4e-15 Identity = 45/65 (69.23%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Spg039439 vs. TAIR 10
Match: AT2G01890.1 (purple acid phosphatase 8 ) HSP 1 Score: 71.2 bits (173), Expect = 5.4e-13 Identity = 35/56 (62.50%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of Spg039439 vs. TAIR 10
Match: AT2G01890.2 (purple acid phosphatase 8 ) HSP 1 Score: 71.2 bits (173), Expect = 5.4e-13 Identity = 35/56 (62.50%), Postives = 42/56 (75.00%), Query Frame = 0
BLAST of Spg039439 vs. TAIR 10
Match: AT3G17790.1 (purple acid phosphatase 17 ) HSP 1 Score: 68.2 bits (165), Expect = 4.5e-12 Identity = 33/70 (47.14%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of Spg039439 vs. TAIR 10
Match: AT1G14700.1 (purple acid phosphatase 3 ) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-11 Identity = 37/80 (46.25%), Postives = 50/80 (62.50%), Query Frame = 0
BLAST of Spg039439 vs. TAIR 10
Match: AT1G14700.2 (purple acid phosphatase 3 ) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-11 Identity = 37/80 (46.25%), Postives = 50/80 (62.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|