Spg037384 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAAAAAGAAAAAAGAAAAAAGAAGTAATAATTATTGGGAGAGGAGAGAAGTGGATGTAAGAGTGAGGTGCGAGTGCGAGGAGTGTATATATAGAAGTGTATCCTCCTCCCATTTTGCTCAGACTTGAACAATAAGGTAAGGCATAGAAATGATGAACAAATCCTTCCTTCCCACGCTTCTATTGCTGCTCCTCATATTCTCTGCTTCGGGTACGTAATTATCCTAATTAATTCCTTCAGTTTGCTGGTTAATTAAATTAATTAATTAGCTAATCATGTAATCATGTGTGTGTATGCAGAGGAGATGATGGGCGGCGCTGGCCGTGCAGACGCTCGAGTGTGCTCGTCGCAGAGCCACCACTTCCACGGGACCTGCTTGAGCGACCACAACTGCGCCGTTGTCTGCCGAACCGAAGGCTTCTCCGGTGGTGACTGTAAGGGCTTCCGCCGCCGCTGCTTCTGCACTCGTCGTTGTTAATGCATTTCCCCGTCCCCGTCCCCGACCCCGACCCCATGTTATCAATAATTAAGTACGTTACCACCCCCACCACCTTAATTACCTTCCCACTAAATGCCCTTTACTCTTGTGTCTTGCGTCTCATTTCCCTTCACCATGTTACTATTATTATTATATATGCTTCCTTCCATTCCCT ATGATGAACAAATCCTTCCTTCCCACGCTTCTATTGCTGCTCCTCATATTCTCTGCTTCGGAGGAGATGATGGGCGGCGCTGGCCGTGCAGACGCTCGAGTGTGCTCGTCGCAGAGCCACCACTTCCACGGGACCTGCTTGAGCGACCACAACTGCGCCGTTGTCTGCCGAACCGAAGGCTTCTCCGGTGGTGACTGTAAGGGCTTCCGCCGCCGCTGCTTCTGCACTCGTCGTTGTTAA ATGATGAACAAATCCTTCCTTCCCACGCTTCTATTGCTGCTCCTCATATTCTCTGCTTCGGAGGAGATGATGGGCGGCGCTGGCCGTGCAGACGCTCGAGTGTGCTCGTCGCAGAGCCACCACTTCCACGGGACCTGCTTGAGCGACCACAACTGCGCCGTTGTCTGCCGAACCGAAGGCTTCTCCGGTGGTGACTGTAAGGGCTTCCGCCGCCGCTGCTTCTGCACTCGTCGTTGTTAA MMNKSFLPTLLLLLLIFSASEEMMGGAGRADARVCSSQSHHFHGTCLSDHNCAVVCRTEGFSGGDCKGFRRRCFCTRRC Homology
BLAST of Spg037384 vs. NCBI nr
Match: AHA50468.1 (defensin-like protein 2 [Citrullus lanatus]) HSP 1 Score: 142.9 bits (359), Expect = 1.2e-30 Identity = 69/79 (87.34%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of Spg037384 vs. NCBI nr
Match: XP_022158825.1 (defensin-like protein 1 [Momordica charantia]) HSP 1 Score: 142.1 bits (357), Expect = 2.0e-30 Identity = 68/78 (87.18%), Postives = 70/78 (89.74%), Query Frame = 0
BLAST of Spg037384 vs. NCBI nr
Match: XP_022973846.1 (defensin-like protein 1 [Cucurbita maxima] >XP_023512106.1 defensin-like protein 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 137.9 bits (346), Expect = 3.8e-29 Identity = 66/79 (83.54%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of Spg037384 vs. NCBI nr
Match: XP_016902617.1 (PREDICTED: defensin-like protein 1 [Cucumis melo]) HSP 1 Score: 137.1 bits (344), Expect = 6.5e-29 Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of Spg037384 vs. NCBI nr
Match: KAG6571314.1 (Defensin-like protein 2, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 136.3 bits (342), Expect = 1.1e-28 Identity = 65/79 (82.28%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy Swiss-Prot
Match: Q9FFP8 (Defensin-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=PDF2.5 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 4.1e-18 Identity = 44/78 (56.41%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy Swiss-Prot
Match: Q40901 (Defensin-like protein OS=Petunia integrifolia OX=4103 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 7.0e-18 Identity = 41/71 (57.75%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy Swiss-Prot
Match: P82659 (Defensin SD2 OS=Helianthus annuus OX=4232 GN=SD2 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.3e-16 Identity = 43/78 (55.13%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy Swiss-Prot
Match: P83399 (Defensin-like protein 1 OS=Vigna unguiculata OX=3917 PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.3e-16 Identity = 35/47 (74.47%), Postives = 39/47 (82.98%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy Swiss-Prot
Match: A3FPF2 (Defensin-like protein OS=Nelumbo nucifera OX=4432 PE=3 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.3e-16 Identity = 42/71 (59.15%), Postives = 51/71 (71.83%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy TrEMBL
Match: W5RNL9 (Defensin-like protein 2 OS=Citrullus lanatus OX=3654 GN=PDF2.2 PE=2 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 5.7e-31 Identity = 69/79 (87.34%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy TrEMBL
Match: A0A6J1DWX4 (defensin-like protein 1 OS=Momordica charantia OX=3673 GN=LOC111025288 PE=4 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 9.8e-31 Identity = 68/78 (87.18%), Postives = 70/78 (89.74%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy TrEMBL
Match: A0A6J1I9R5 (defensin-like protein 1 OS=Cucurbita maxima OX=3661 GN=LOC111472388 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 1.8e-29 Identity = 66/79 (83.54%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy TrEMBL
Match: A0A1S4E313 (defensin-like protein 1 OS=Cucumis melo OX=3656 GN=LOC103499593 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 3.1e-29 Identity = 64/79 (81.01%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of Spg037384 vs. ExPASy TrEMBL
Match: A0A6J1EVR5 (defensin-like protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111438308 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.6e-28 Identity = 64/79 (81.01%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Spg037384 vs. TAIR 10
Match: AT5G63660.1 (Scorpion toxin-like knottin superfamily protein ) HSP 1 Score: 91.7 bits (226), Expect = 2.9e-19 Identity = 44/78 (56.41%), Postives = 53/78 (67.95%), Query Frame = 0
BLAST of Spg037384 vs. TAIR 10
Match: AT2G02130.1 (low-molecular-weight cysteine-rich 68 ) HSP 1 Score: 84.0 bits (206), Expect = 6.1e-17 Identity = 39/74 (52.70%), Postives = 48/74 (64.86%), Query Frame = 0
BLAST of Spg037384 vs. TAIR 10
Match: AT2G02100.1 (low-molecular-weight cysteine-rich 69 ) HSP 1 Score: 83.2 bits (204), Expect = 1.0e-16 Identity = 39/78 (50.00%), Postives = 51/78 (65.38%), Query Frame = 0
BLAST of Spg037384 vs. TAIR 10
Match: AT2G02120.1 (Scorpion toxin-like knottin superfamily protein ) HSP 1 Score: 81.3 bits (199), Expect = 3.9e-16 Identity = 39/73 (53.42%), Postives = 48/73 (65.75%), Query Frame = 0
BLAST of Spg037384 vs. TAIR 10
Match: AT1G61070.1 (low-molecular-weight cysteine-rich 66 ) HSP 1 Score: 75.9 bits (185), Expect = 1.7e-14 Identity = 37/67 (55.22%), Postives = 44/67 (65.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|