Spg035355 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GTTAATATTATTTTTTAAAACAGTGTGCATCGGCCAAATTGGGTATAAATATTGGTAGCTGAGACATTAACAAAGCATCCCCAATCGACCATCAGCTAAGAAAACAAAGAAGACAGTGTGAGAGTTTTGAGATGTCTCATTCTACAGGTTTGCAAACCTCTCCTTTCAAACCTCATGCATTTCAAATGCTTCTTATTTTCCATGGCAATTTTGTTTATTTATTTCTTTTACTACTTTGGATTTAATGTGTGTCATTCTATGATTCAAATTAGGAAAACGACAATGGCCAGAACTTGTCGGTGTTCCAGCCGACATTGCAAAGCTTATCATAGGAAAAGACAATCCTGCTATAGATCAAATACCGGTATTATTAGCAGGATCTCCAGTAACTCGGGATCACAGAGAGGATCGAGTTCGAATATTTGTTAATACAATCTATATTTGTGTTATTCCTCCTGTAGTTGGTTGAAATGAGATATGAATATCTATGTTTGAACGGGTTAAGATATTAATAAAATAAGGTAGAATAATCTTTTTCTACCCTTTAAATGATTTGTGTAAGATCTGTTTTTAATTTAAAATATTATT ATGTCTCATTCTACAGGAAAACGACAATGGCCAGAACTTGTCGGTGTTCCAGCCGACATTGCAAAGCTTATCATAGGAAAAGACAATCCTGCTATAGATCAAATACCGGTATTATTAGCAGGATCTCCAGTAACTCGGGATCACAGAGAGGATCGAGTTCGAATATTTGTTAATACAATCTATATTTGTGTTATTCCTCCTGTAGTTGGTTGA ATGTCTCATTCTACAGGAAAACGACAATGGCCAGAACTTGTCGGTGTTCCAGCCGACATTGCAAAGCTTATCATAGGAAAAGACAATCCTGCTATAGATCAAATACCGGTATTATTAGCAGGATCTCCAGTAACTCGGGATCACAGAGAGGATCGAGTTCGAATATTTGTTAATACAATCTATATTTGTGTTATTCCTCCTGTAGTTGGTTGA MSHSTGKRQWPELVGVPADIAKLIIGKDNPAIDQIPVLLAGSPVTRDHREDRVRIFVNTIYICVIPPVVG Homology
BLAST of Spg035355 vs. NCBI nr
Match: XP_004247655.1 (wound-induced proteinase inhibitor 1-like [Solanum lycopersicum]) HSP 1 Score: 79.3 bits (194), Expect = 1.4e-11 Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of Spg035355 vs. NCBI nr
Match: TMW85239.1 (hypothetical protein EJD97_023458 [Solanum chilense]) HSP 1 Score: 79.3 bits (194), Expect = 1.4e-11 Identity = 40/68 (58.82%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of Spg035355 vs. NCBI nr
Match: P16231.1 (RecName: Full=Wound-induced proteinase inhibitor 1; AltName: Full=Wound-induced proteinase inhibitor I; Flags: Precursor [Solanum peruvianum] >AAA34180.1 proteinase inhibitor I precursor [Solanum peruvianum]) HSP 1 Score: 78.2 bits (191), Expect = 3.2e-11 Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 0
BLAST of Spg035355 vs. NCBI nr
Match: NP_001315434.1 (proteinase inhibitor I precursor [Solanum lycopersicum]) HSP 1 Score: 78.2 bits (191), Expect = 3.2e-11 Identity = 36/55 (65.45%), Postives = 44/55 (80.00%), Query Frame = 0
BLAST of Spg035355 vs. NCBI nr
Match: AAA34198.1 (proteinase inhibitor I [Solanum peruvianum]) HSP 1 Score: 78.2 bits (191), Expect = 3.2e-11 Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.2e-14 Identity = 37/59 (62.71%), Postives = 45/59 (76.27%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy Swiss-Prot
Match: P05118 (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 GN=PIIF PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.1e-14 Identity = 36/64 (56.25%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy Swiss-Prot
Match: Q00783 (Proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 6.6e-12 Identity = 36/65 (55.38%), Postives = 44/65 (67.69%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 1.9e-11 Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy Swiss-Prot
Match: P08454 (Wound-induced proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=1 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 7.3e-11 Identity = 30/55 (54.55%), Postives = 41/55 (74.55%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy TrEMBL
Match: A0A3Q7J2Q4 (Uncharacterized protein OS=Solanum lycopersicum OX=4081 GN=101247257 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 6.9e-12 Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy TrEMBL
Match: A0A6N2AU12 (Uncharacterized protein OS=Solanum chilense OX=4083 GN=EJD97_023458 PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 6.9e-12 Identity = 40/68 (58.82%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy TrEMBL
Match: A0A3Q7I868 (Uncharacterized protein OS=Solanum lycopersicum OX=4081 GN=101247557 PE=3 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 1.5e-11 Identity = 36/55 (65.45%), Postives = 44/55 (80.00%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy TrEMBL
Match: A0A6N2B1Z1 (Uncharacterized protein OS=Solanum chilense OX=4083 GN=EJD97_018438 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 2.6e-11 Identity = 39/64 (60.94%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Spg035355 vs. ExPASy TrEMBL
Match: A0A6N2AU19 (Uncharacterized protein OS=Solanum chilense OX=4083 GN=EJD97_023457 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 7.6e-11 Identity = 37/65 (56.92%), Postives = 46/65 (70.77%), Query Frame = 0
BLAST of Spg035355 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 58.2 bits (139), Expect = 3.2e-09 Identity = 30/64 (46.88%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of Spg035355 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 44.3 bits (103), Expect = 4.7e-05 Identity = 23/65 (35.38%), Postives = 37/65 (56.92%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|