![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Spg033229 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGCCCATTGGACTCCAGGTAAACGAGTGAACCTTAATCCAGAAGACGAGCAATTGCTGACTCATCGTACACGTGGACGGCGGAGATGCAATTCCATGTTCCACATCAACTTTTCAAAGAAATGGTTCCTTATTTCCGTCTGACGCTTGTCCCGTTATTGGCATTTTAAAGCAAACCCAGGTTCCGTTCCTCGTTGTCAGTTCTCTCACGTTTTCCTTTCATTCGCTCGCACTAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGCAGCAGCAGCCACAGAAAGAAATGGTGAAGGATCGGAAGATCGGAGTGGCTCTTGATTTCTCCAACAGCAGCAAAAACGCTCTCAAATGGGCCATCGATAACTTGGCCGACAAAGGCGACACTCTCTACATCATCTACGTTAACCCCAATTCACTCGACGAATCTGCCCATCACCTCTGGGCTCAATCCGGCTCTCGTCAGTAA ATGAGGCCCATTGGACTCCAGTTCTCTCACGTTTTCCTTTCATTCGCTCGCACTAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGCAGCAGCAGCCACAGAAAGAAATGGTGAAGGATCGGAAGATCGGAGTGGCTCTTGATTTCTCCAACAGCAGCAAAAACGCTCTCAAATGGGCCATCGATAACTTGGCCGACAAAGGCGACACTCTCTACATCATCTACGTTAACCCCAATTCACTCGACGAATCTGCCCATCACCTCTGGGCTCAATCCGGCTCTCGTCAGTAA ATGAGGCCCATTGGACTCCAGTTCTCTCACGTTTTCCTTTCATTCGCTCGCACTAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGCAGCAGCAGCCACAGAAAGAAATGGTGAAGGATCGGAAGATCGGAGTGGCTCTTGATTTCTCCAACAGCAGCAAAAACGCTCTCAAATGGGCCATCGATAACTTGGCCGACAAAGGCGACACTCTCTACATCATCTACGTTAACCCCAATTCACTCGACGAATCTGCCCATCACCTCTGGGCTCAATCCGGCTCTCGTCAGTAA MRPIGLQFSHVFLSFARTKKKKKKKKKKQQQPQKEMVKDRKIGVALDFSNSSKNALKWAIDNLADKGDTLYIIYVNPNSLDESAHHLWAQSGSRQ Homology
BLAST of Spg033229 vs. NCBI nr
Match: XP_038903504.1 (universal stress protein PHOS32 [Benincasa hispida]) HSP 1 Score: 114.4 bits (285), Expect = 5.4e-22 Identity = 54/58 (93.10%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Spg033229 vs. NCBI nr
Match: XP_008442491.1 (PREDICTED: uncharacterized protein C167.05 [Cucumis melo] >KAA0044129.1 universal stress protein PHOS32-like [Cucumis melo var. makuwa] >TYK25009.1 universal stress protein PHOS32-like [Cucumis melo var. makuwa]) HSP 1 Score: 113.2 bits (282), Expect = 1.2e-21 Identity = 54/58 (93.10%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Spg033229 vs. NCBI nr
Match: XP_011651876.1 (universal stress protein PHOS32 [Cucumis sativus] >KGN58822.1 hypothetical protein Csa_001140 [Cucumis sativus]) HSP 1 Score: 112.8 bits (281), Expect = 1.6e-21 Identity = 53/58 (91.38%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Spg033229 vs. NCBI nr
Match: XP_022145652.1 (universal stress protein PHOS32 [Momordica charantia]) HSP 1 Score: 112.5 bits (280), Expect = 2.1e-21 Identity = 52/58 (89.66%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of Spg033229 vs. NCBI nr
Match: XP_022935543.1 (universal stress protein PHOS32-like [Cucurbita moschata]) HSP 1 Score: 107.5 bits (267), Expect = 6.6e-20 Identity = 50/59 (84.75%), Postives = 57/59 (96.61%), Query Frame = 0
BLAST of Spg033229 vs. ExPASy Swiss-Prot
Match: Q8L4N1 (Universal stress protein PHOS34 OS=Arabidopsis thaliana OX=3702 GN=PHOS34 PE=1 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 6.9e-04 Identity = 19/41 (46.34%), Postives = 29/41 (70.73%), Query Frame = 0
BLAST of Spg033229 vs. ExPASy Swiss-Prot
Match: Q8VYN9 (Universal stress protein PHOS32 OS=Arabidopsis thaliana OX=3702 GN=PHOS32 PE=1 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 9.0e-04 Identity = 18/41 (43.90%), Postives = 29/41 (70.73%), Query Frame = 0
BLAST of Spg033229 vs. ExPASy TrEMBL
Match: A0A5A7TSD0 (Universal stress protein PHOS32-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G001270 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 5.9e-22 Identity = 54/58 (93.10%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Spg033229 vs. ExPASy TrEMBL
Match: A0A1S3B5T0 (uncharacterized protein C167.05 OS=Cucumis melo OX=3656 GN=LOC103486344 PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 5.9e-22 Identity = 54/58 (93.10%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Spg033229 vs. ExPASy TrEMBL
Match: A0A0A0LDK3 (Usp domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G733270 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 7.6e-22 Identity = 53/58 (91.38%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of Spg033229 vs. ExPASy TrEMBL
Match: A0A6J1CXB3 (universal stress protein PHOS32 OS=Momordica charantia OX=3673 GN=LOC111015049 PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 1.0e-21 Identity = 52/58 (89.66%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of Spg033229 vs. ExPASy TrEMBL
Match: A0A6J1FAU1 (universal stress protein PHOS32-like OS=Cucurbita moschata OX=3662 GN=LOC111442383 PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 3.2e-20 Identity = 50/59 (84.75%), Postives = 57/59 (96.61%), Query Frame = 0
BLAST of Spg033229 vs. TAIR 10
Match: AT3G53990.2 (Adenine nucleotide alpha hydrolases-like superfamily protein ) HSP 1 Score: 85.9 bits (211), Expect = 1.9e-17 Identity = 41/58 (70.69%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of Spg033229 vs. TAIR 10
Match: AT3G53990.1 (Adenine nucleotide alpha hydrolases-like superfamily protein ) HSP 1 Score: 85.9 bits (211), Expect = 1.9e-17 Identity = 41/58 (70.69%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of Spg033229 vs. TAIR 10
Match: AT3G03270.1 (Adenine nucleotide alpha hydrolases-like superfamily protein ) HSP 1 Score: 55.8 bits (133), Expect = 2.1e-08 Identity = 25/58 (43.10%), Postives = 40/58 (68.97%), Query Frame = 0
BLAST of Spg033229 vs. TAIR 10
Match: AT3G03270.2 (Adenine nucleotide alpha hydrolases-like superfamily protein ) HSP 1 Score: 55.8 bits (133), Expect = 2.1e-08 Identity = 25/58 (43.10%), Postives = 40/58 (68.97%), Query Frame = 0
BLAST of Spg033229 vs. TAIR 10
Match: AT3G17020.1 (Adenine nucleotide alpha hydrolases-like superfamily protein ) HSP 1 Score: 50.8 bits (120), Expect = 6.9e-07 Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|