Spg031701 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTGAAGAATCTGCTCCTCGTAAGTTCATCCTATCAATACTCCATTTTGAAAAACTTGGTTCCATGGAATGATTTGTGCATGCACACAACCATAACATTATTGCATTTTTGGAAAAATCATTGAATAGAAAAATCATTGAGACGAAAGAAGAGAAAAACGCAGAGGGATTCCAAGAGAAAAATCTCTATCACATTGAATTGAATTCAACTATTGAAGAGGCAGCTACATATATACTGCTAGATAGAGATGAAAAAACTCTTGGAAAAATAATAACAAACCCTAACCCTAGATCACGAAATCTTACCTCTGAGAGCTATCACGAAAATTACATCAGAGAGAGTGAGAGTTCTAGAAGACAACTATTCTAGAACCTTTACATATAACCCTATCAATCTGATAAAGAGAAAATGGGTTGGGCTTCATAATATGGGCTTATGCCTTTTACAAAGAGTATGAGCTGGACAAATAATAAAATTTCAGTGGGCTGCCTTTACGTTAACATCTTCGTCGTAGTTTTTTTTTTTTTTTTATGTAATTAAGATTTATTATTATAAATACCTTTTGAGTGTATTTGATTGGATTATATATAGGTGATATTTATTGCCAAATTTAACACAAATGTATTTCTAAATAGGGAAAAGTCAATGGCCAGAGCTTGTCTTTGTAAAATTCTCTATTGCTGCTGCGATCATAGAAAAAGAGAATCCTGATGTCACAGCTTTCAAGATCCTATCTGGGAGTAAAAGAATTATGGATTTTGATCGTACACGAGTTTTTGTTGATGTCAATATTGAAGATGTGGTTGTTAAAGTTCCTAAGGTCGGCTAG ATGTCTGAAGAATCTGCTCCTCGGAAAAGTCAATGGCCAGAGCTTGTCTTTGTAAAATTCTCTATTGCTGCTGCGATCATAGAAAAAGAGAATCCTGATGTCACAGCTTTCAAGATCCTATCTGGGAGTAAAAGAATTATGGATTTTGATCGTACACGAGTTTTTGTTGATGTCAATATTGAAGATGTGGTTGTTAAAGTTCCTAAGGTCGGCTAG ATGTCTGAAGAATCTGCTCCTCGGAAAAGTCAATGGCCAGAGCTTGTCTTTGTAAAATTCTCTATTGCTGCTGCGATCATAGAAAAAGAGAATCCTGATGTCACAGCTTTCAAGATCCTATCTGGGAGTAAAAGAATTATGGATTTTGATCGTACACGAGTTTTTGTTGATGTCAATATTGAAGATGTGGTTGTTAAAGTTCCTAAGGTCGGCTAG MSEESAPRKSQWPELVFVKFSIAAAIIEKENPDVTAFKILSGSKRIMDFDRTRVFVDVNIEDVVVKVPKVG Homology
BLAST of Spg031701 vs. NCBI nr
Match: KGN56897.1 (hypothetical protein Csa_010510 [Cucumis sativus]) HSP 1 Score: 111.7 bits (278), Expect = 2.6e-21 Identity = 54/71 (76.06%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of Spg031701 vs. NCBI nr
Match: KAA0049288.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17270.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 105.1 bits (261), Expect = 2.5e-19 Identity = 49/68 (72.06%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of Spg031701 vs. NCBI nr
Match: KAA0049287.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17271.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 105.1 bits (261), Expect = 2.5e-19 Identity = 52/69 (75.36%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Spg031701 vs. NCBI nr
Match: KAA0049286.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17272.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 99.0 bits (245), Expect = 1.8e-17 Identity = 50/71 (70.42%), Postives = 59/71 (83.10%), Query Frame = 0
BLAST of Spg031701 vs. NCBI nr
Match: KAE8650337.1 (hypothetical protein Csa_010581 [Cucumis sativus]) HSP 1 Score: 90.1 bits (222), Expect = 8.2e-15 Identity = 47/68 (69.12%), Postives = 54/68 (79.41%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 8.5e-07 Identity = 30/67 (44.78%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 31/67 (46.27%), Postives = 38/67 (56.72%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 28/64 (43.75%), Postives = 37/64 (57.81%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy Swiss-Prot
Match: P20076 (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 3.6e-05 Identity = 28/64 (43.75%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy TrEMBL
Match: A0A0A0L8E6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142910 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.3e-21 Identity = 54/71 (76.06%), Postives = 65/71 (91.55%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy TrEMBL
Match: A0A5A7U228 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001230 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.2e-19 Identity = 49/68 (72.06%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy TrEMBL
Match: A0A5A7U4L9 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001240 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 1.2e-19 Identity = 52/69 (75.36%), Postives = 59/69 (85.51%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy TrEMBL
Match: A0A5A7U4U0 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001250 PE=3 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 8.5e-18 Identity = 50/71 (70.42%), Postives = 59/71 (83.10%), Query Frame = 0
BLAST of Spg031701 vs. ExPASy TrEMBL
Match: A0A0A0L785 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G141900 PE=3 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 2.1e-16 Identity = 49/71 (69.01%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of Spg031701 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 60.8 bits (146), Expect = 5.0e-10 Identity = 39/73 (53.42%), Postives = 43/73 (58.90%), Query Frame = 0
BLAST of Spg031701 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 48.1 bits (113), Expect = 3.3e-06 Identity = 28/65 (43.08%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of Spg031701 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 47.4 bits (111), Expect = 5.7e-06 Identity = 26/64 (40.62%), Postives = 35/64 (54.69%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|