Spg031287 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AGCCCACGGATATTGGCATTGACGAATGCCACACTGGCTTTTGCCGGTTTCTTCTCCGTTCTCTCTCTTTTATAAAAACCAAATCACCACGTTATCCTCCGCCACTCTCTCTCTCTCTCTCTCTTCTTCTTCAACCTTTCATCAGAGCTTCGACGGACTGCAACAATGGCGTCCTCCCATTCCACTTCTAGGGCTTTCTCCGGCTTCTTCACATTCTTCGCTCTCCTCCTCTTCATTCTCTCGCCACTCGTTGACGCGCACTCTTCGGCCCCTGCTCCCCCTCCCGCTCCCGCAAGCGACGGTATCTAGATCCAACCTCCTTTCCATCTCCGGTTTATTTTTCTTTTCGCGTTCTTCTTTTTTCTTTTGTCTTCTTTGTCGGATGATGAAGAAGAATAATGTAGGTCTTTCGATTAGGGATTTCCGTTCTAGCACGAGCGATTACTTGCATTGCATTCTGAAATTCGGTTGGTTCGTAGGGAGATTTTCTGATTTGGAAGTGATTTGTTGATGGTTTTGTGCAAAATCAGGGACCTCCATAGACCAAGGGATTGCGTACGTGCTGATGCTGTTGGCGTTGGTTCTCACATACCTAATCCATCCTCTCGATGCGTCTTCCTACAACTTTTTTCTGAATTGAATTGTAGGATTGTAGCAATGTTGGCGCTGTTTTTGGGATTTGAAGATGCGTTTGTGGATAAATCATTGAAGGAAGTAGGGCCAACTTTCTTTCTCTCGTTGTGATAAAATGTAGGGTTGGAGAGGAATGTGCATATTGGGTTTGGCAAATTTTGATCAATTGTCTGATTGTTTATTCGATTACTTTTCTTTTCTTTCTTTTTTCCAATCATAATTTATTCATTGGATCCATTTTTCAAAGCTTTTCGAGTCTGCGACTTTGTTTGATTCCACCATTCTTTTTCTAATGTTATTGTCATCTTGAAGAGAATAGAATAGGGCCTTCACGTTGTGATTGAACTCTTCAAAAGTTTATCTAATTTCATCAATGGCCAAGCAAAACCTTCTGTAATTGTGTTTCTCTTCTCAAGAGGAGAGGCAAAAAACAATCAAAATAAGGAA ATGGCGTCCTCCCATTCCACTTCTAGGGCTTTCTCCGGCTTCTTCACATTCTTCGCTCTCCTCCTCTTCATTCTCTCGCCACTCGTTGACGCGCACTCTTCGGCCCCTGCTCCCCCTCCCGCTCCCGCAAGCGACGGGACCTCCATAGACCAAGGGATTGCGTACGTGCTGATGCTGTTGGCGTTGGTTCTCACATACCTAATCCATCCTCTCGATGCGTCTTCCTACAACTTTTTTCTGAATTGA ATGGCGTCCTCCCATTCCACTTCTAGGGCTTTCTCCGGCTTCTTCACATTCTTCGCTCTCCTCCTCTTCATTCTCTCGCCACTCGTTGACGCGCACTCTTCGGCCCCTGCTCCCCCTCCCGCTCCCGCAAGCGACGGGACCTCCATAGACCAAGGGATTGCGTACGTGCTGATGCTGTTGGCGTTGGTTCTCACATACCTAATCCATCCTCTCGATGCGTCTTCCTACAACTTTTTTCTGAATTGA MASSHSTSRAFSGFFTFFALLLFILSPLVDAHSSAPAPPPAPASDGTSIDQGIAYVLMLLALVLTYLIHPLDASSYNFFLN Homology
BLAST of Spg031287 vs. NCBI nr
Match: XP_023528757.1 (arabinogalactan peptide 16-like [Cucurbita pepo subsp. pepo] >KAG7019041.1 Arabinogalactan peptide 16 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 142.5 bits (358), Expect = 1.6e-30 Identity = 73/81 (90.12%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Spg031287 vs. NCBI nr
Match: XP_022924337.1 (arabinogalactan peptide 16-like [Cucurbita moschata] >KAG6582645.1 Arabinogalactan protein 16, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 139.0 bits (349), Expect = 1.8e-29 Identity = 74/83 (89.16%), Postives = 78/83 (93.98%), Query Frame = 0
BLAST of Spg031287 vs. NCBI nr
Match: XP_022147463.1 (arabinogalactan peptide 20-like [Momordica charantia]) HSP 1 Score: 137.5 bits (345), Expect = 5.1e-29 Identity = 73/81 (90.12%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of Spg031287 vs. NCBI nr
Match: XP_022979386.1 (arabinogalactan peptide 20-like [Cucurbita maxima]) HSP 1 Score: 131.7 bits (330), Expect = 2.8e-27 Identity = 70/83 (84.34%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Spg031287 vs. NCBI nr
Match: XP_038905636.1 (arabinogalactan protein 41-like [Benincasa hispida]) HSP 1 Score: 129.0 bits (323), Expect = 1.8e-26 Identity = 70/81 (86.42%), Postives = 74/81 (91.36%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy Swiss-Prot
Match: Q9M373 (Arabinogalactan protein 20 OS=Arabidopsis thaliana OX=3702 GN=AGP20 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 8.2e-14 Identity = 45/74 (60.81%), Postives = 52/74 (70.27%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy Swiss-Prot
Match: O82337 (Arabinogalactan protein 16 OS=Arabidopsis thaliana OX=3702 GN=AGP16 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.8e-13 Identity = 43/66 (65.15%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy Swiss-Prot
Match: Q8L9T8 (Arabinogalactan protein 41 OS=Arabidopsis thaliana OX=3702 GN=AGP41 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 7.7e-12 Identity = 40/64 (62.50%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy Swiss-Prot
Match: Q9FK16 (Arabinogalactan protein 22 OS=Arabidopsis thaliana OX=3702 GN=AGP22 PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.5e-10 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy TrEMBL
Match: A0A6J1E8M6 (arabinogalactan peptide 16-like OS=Cucurbita moschata OX=3662 GN=LOC111431859 PE=4 SV=1) HSP 1 Score: 139.0 bits (349), Expect = 8.5e-30 Identity = 74/83 (89.16%), Postives = 78/83 (93.98%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy TrEMBL
Match: A0A6J1D1D7 (arabinogalactan peptide 20-like OS=Momordica charantia OX=3673 GN=LOC111016381 PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 2.5e-29 Identity = 73/81 (90.12%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy TrEMBL
Match: A0A6J1IQM6 (arabinogalactan peptide 20-like OS=Cucurbita maxima OX=3661 GN=LOC111479127 PE=4 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 1.4e-27 Identity = 70/83 (84.34%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy TrEMBL
Match: A0A6J1IAU1 (arabinogalactan peptide 16-like OS=Cucurbita maxima OX=3661 GN=LOC111473327 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 9.7e-26 Identity = 67/80 (83.75%), Postives = 70/80 (87.50%), Query Frame = 0
BLAST of Spg031287 vs. ExPASy TrEMBL
Match: A0A6J1F1F2 (arabinogalactan peptide 20-like OS=Cucurbita moschata OX=3662 GN=LOC111441255 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 9.7e-26 Identity = 67/79 (84.81%), Postives = 70/79 (88.61%), Query Frame = 0
BLAST of Spg031287 vs. TAIR 10
Match: AT3G61640.1 (arabinogalactan protein 20 ) HSP 1 Score: 77.4 bits (189), Expect = 5.8e-15 Identity = 45/74 (60.81%), Postives = 52/74 (70.27%), Query Frame = 0
BLAST of Spg031287 vs. TAIR 10
Match: AT2G46330.1 (arabinogalactan protein 16 ) HSP 1 Score: 76.3 bits (186), Expect = 1.3e-14 Identity = 43/66 (65.15%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of Spg031287 vs. TAIR 10
Match: AT5G24105.1 (arabinogalactan protein 41 ) HSP 1 Score: 70.9 bits (172), Expect = 5.5e-13 Identity = 40/64 (62.50%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of Spg031287 vs. TAIR 10
Match: AT5G53250.1 (arabinogalactan protein 22 ) HSP 1 Score: 65.9 bits (159), Expect = 1.8e-11 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|