Spg029820 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGACTTAGACAAGTTTCTGAAGAGGAAAGAGTTTTACAAGAGAGTTGGGAGGGCTTGGAAGAGAGGGTATTTGTTGTACGGGCCGCCGGGGACTGGGAAATCGAGCTTGGTGGCGGCCATGTCGAATTACTTGAAGTTTGATATTTATGATCTGCAATTGGCGAATGTGGTGCAGGATTCGGATTTGAGGAAGCTGCTTTTGACGACGGGGAATCGCTCCATTTTGGTCATTGAGGATATTGATTGTACTGTTGAGCTGCCGGATCGCCGCCCTGGTGCTGACTGGCCGACGCATCCTTCTGAAATTCAGGTTGGTTTGCTCTGA ATGGAGGACTTAGACAAGTTTCTGAAGAGGAAAGAGTTTTACAAGAGAGTTGGGAGGGCTTGGAAGAGAGGGTATTTGTTGTACGGGCCGCCGGGGACTGGGAAATCGAGCTTGGTGGCGGCCATGTCGAATTACTTGAAGTTTGATATTTATGATCTGCAATTGGCGAATGTGGTGCAGGATTCGGATTTGAGGAAGCTGCTTTTGACGACGGGGAATCGCTCCATTTTGGTCATTGAGGATATTGATTGTACTGTTGAGCTGCCGGATCGCCGCCCTGGTGCTGACTGGCCGACGCATCCTTCTGAAATTCAGGTTGGTTTGCTCTGA ATGGAGGACTTAGACAAGTTTCTGAAGAGGAAAGAGTTTTACAAGAGAGTTGGGAGGGCTTGGAAGAGAGGGTATTTGTTGTACGGGCCGCCGGGGACTGGGAAATCGAGCTTGGTGGCGGCCATGTCGAATTACTTGAAGTTTGATATTTATGATCTGCAATTGGCGAATGTGGTGCAGGATTCGGATTTGAGGAAGCTGCTTTTGACGACGGGGAATCGCTCCATTTTGGTCATTGAGGATATTGATTGTACTGTTGAGCTGCCGGATCGCCGCCCTGGTGCTGACTGGCCGACGCATCCTTCTGAAATTCAGGTTGGTTTGCTCTGA MEDLDKFLKRKEFYKRVGRAWKRGYLLYGPPGTGKSSLVAAMSNYLKFDIYDLQLANVVQDSDLRKLLLTTGNRSILVIEDIDCTVELPDRRPGADWPTHPSEIQVGLL Homology
BLAST of Spg029820 vs. NCBI nr
Match: KAG6600594.1 (AAA-ATPase, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 195.7 bits (496), Expect = 2.1e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. NCBI nr
Match: XP_022943069.1 (AAA-ATPase At5g17760-like isoform X2 [Cucurbita moschata] >XP_022943070.1 AAA-ATPase At5g17760-like isoform X3 [Cucurbita moschata]) HSP 1 Score: 195.7 bits (496), Expect = 2.1e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. NCBI nr
Match: KAG7031231.1 (AAA-ATPase, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 195.7 bits (496), Expect = 2.1e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. NCBI nr
Match: XP_022943071.1 (AAA-ATPase At5g17760-like isoform X4 [Cucurbita moschata]) HSP 1 Score: 195.7 bits (496), Expect = 2.1e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. NCBI nr
Match: XP_022943068.1 (AAA-ATPase At5g17760-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 195.7 bits (496), Expect = 2.1e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy Swiss-Prot
Match: Q9FN75 (AAA-ATPase At5g17760 OS=Arabidopsis thaliana OX=3702 GN=At5g17760 PE=3 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 3.4e-39 Identity = 75/91 (82.42%), Postives = 88/91 (96.70%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy Swiss-Prot
Match: F4KID5 (AAA-ATPase At5g17750 OS=Arabidopsis thaliana OX=3702 GN=At5g17750 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 7.9e-36 Identity = 70/91 (76.92%), Postives = 81/91 (89.01%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy Swiss-Prot
Match: Q9FN77 (AAA-ATPase At5g17740 OS=Arabidopsis thaliana OX=3702 GN=At5g17740 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.3e-35 Identity = 71/91 (78.02%), Postives = 82/91 (90.11%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy Swiss-Prot
Match: Q8VZG2 (Protein HYPER-SENSITIVITY-RELATED 4 OS=Arabidopsis thaliana OX=3702 GN=HSR4 PE=2 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.3e-35 Identity = 70/103 (67.96%), Postives = 88/103 (85.44%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy Swiss-Prot
Match: Q8GW96 (AAA-ATPase At2g18193 OS=Arabidopsis thaliana OX=3702 GN=At2g18193 PE=2 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 3.3e-34 Identity = 64/91 (70.33%), Postives = 84/91 (92.31%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy TrEMBL
Match: A0A6J1FT76 (AAA-ATPase At5g17760-like isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111447916 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 1.0e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy TrEMBL
Match: A0A6J1IZ91 (AAA-ATPase At5g17760-like OS=Cucurbita maxima OX=3661 GN=LOC111479789 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 1.0e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy TrEMBL
Match: A0A6J1FWA7 (AAA-ATPase At5g17760-like isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111447916 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 1.0e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy TrEMBL
Match: A0A6J1FQQ5 (AAA-ATPase At5g17760-like isoform X4 OS=Cucurbita moschata OX=3662 GN=LOC111447916 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 1.0e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. ExPASy TrEMBL
Match: A0A6J1FWA9 (AAA-ATPase At5g17760-like isoform X5 OS=Cucurbita moschata OX=3662 GN=LOC111447916 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 1.0e-46 Identity = 96/108 (88.89%), Postives = 103/108 (95.37%), Query Frame = 0
BLAST of Spg029820 vs. TAIR 10
Match: AT5G17760.1 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 162.2 bits (409), Expect = 2.4e-40 Identity = 75/91 (82.42%), Postives = 88/91 (96.70%), Query Frame = 0
BLAST of Spg029820 vs. TAIR 10
Match: AT5G17760.2 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 162.2 bits (409), Expect = 2.4e-40 Identity = 75/91 (82.42%), Postives = 88/91 (96.70%), Query Frame = 0
BLAST of Spg029820 vs. TAIR 10
Match: AT5G17750.1 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 151.0 bits (380), Expect = 5.6e-37 Identity = 70/91 (76.92%), Postives = 81/91 (89.01%), Query Frame = 0
BLAST of Spg029820 vs. TAIR 10
Match: AT3G50930.1 (cytochrome BC1 synthesis ) HSP 1 Score: 149.4 bits (376), Expect = 1.6e-36 Identity = 70/103 (67.96%), Postives = 88/103 (85.44%), Query Frame = 0
BLAST of Spg029820 vs. TAIR 10
Match: AT5G17740.1 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 149.4 bits (376), Expect = 1.6e-36 Identity = 71/91 (78.02%), Postives = 82/91 (90.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|