Spg028195 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAGATACTTCCGAGAACAGCCAAGGTTTCCAAAGAAGCCAAAGAGACAATGCAAGAATGTGCGACTGAGTTCATCAGCTTCGTAACAAGTGAAGCAGCAGAAAAGTGTCAGAAAGAGAATCGTAGAACTCTCAATGGAGACGATATTTGTTGGGCTTTTGGTGCCCTTGGCTTAGACAACTATGCTGAGGCTTCTGCCAAGTACTTGTTCAAGTATAGAGATGATGAGAGAATCAAGGCTGAGAACAAAAGCAATATATAA ATGAAGAAGATACTTCCGAGAACAGCCAAGGTTTCCAAAGAAGCCAAAGAGACAATGCAAGAATGTGCGACTGAGTTCATCAGCTTCGTAACAAGTGAAGCAGCAGAAAAGTGTCAGAAAGAGAATCGTAGAACTCTCAATGGAGACGATATTTGTTGGGCTTTTGGTGCCCTTGGCTTAGACAACTATGCTGAGGCTTCTGCCAAGTACTTGTTCAAGTATAGAGATGATGAGAGAATCAAGGCTGAGAACAAAAGCAATATATAA ATGAAGAAGATACTTCCGAGAACAGCCAAGGTTTCCAAAGAAGCCAAAGAGACAATGCAAGAATGTGCGACTGAGTTCATCAGCTTCGTAACAAGTGAAGCAGCAGAAAAGTGTCAGAAAGAGAATCGTAGAACTCTCAATGGAGACGATATTTGTTGGGCTTTTGGTGCCCTTGGCTTAGACAACTATGCTGAGGCTTCTGCCAAGTACTTGTTCAAGTATAGAGATGATGAGAGAATCAAGGCTGAGAACAAAAGCAATATATAA MKKILPRTAKVSKEAKETMQECATEFISFVTSEAAEKCQKENRRTLNGDDICWAFGALGLDNYAEASAKYLFKYRDDERIKAENKSNI Homology
BLAST of Spg028195 vs. NCBI nr
Match: XP_022968852.1 (nuclear transcription factor Y subunit B-4-like [Cucurbita maxima]) HSP 1 Score: 151.0 bits (380), Expect = 4.8e-33 Identity = 74/88 (84.09%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of Spg028195 vs. NCBI nr
Match: XP_023546470.1 (nuclear transcription factor Y subunit B-4-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 151.0 bits (380), Expect = 4.8e-33 Identity = 74/88 (84.09%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of Spg028195 vs. NCBI nr
Match: KAG6590402.1 (Nuclear transcription factor Y subunit B-4, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 151.0 bits (380), Expect = 4.8e-33 Identity = 74/88 (84.09%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of Spg028195 vs. NCBI nr
Match: XP_022961414.1 (nuclear transcription factor Y subunit B-4-like [Cucurbita moschata]) HSP 1 Score: 151.0 bits (380), Expect = 4.8e-33 Identity = 74/88 (84.09%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of Spg028195 vs. NCBI nr
Match: XP_038880507.1 (nuclear transcription factor Y subunit B-4-like [Benincasa hispida]) HSP 1 Score: 143.3 bits (360), Expect = 1.0e-30 Identity = 69/86 (80.23%), Postives = 76/86 (88.37%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy Swiss-Prot
Match: O04027 (Nuclear transcription factor Y subunit B-4 OS=Arabidopsis thaliana OX=3702 GN=NFYB4 PE=1 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.0e-26 Identity = 56/84 (66.67%), Postives = 70/84 (83.33%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy Swiss-Prot
Match: O82248 (Nuclear transcription factor Y subunit B-5 OS=Arabidopsis thaliana OX=3702 GN=NFYB5 PE=1 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.2e-23 Identity = 52/75 (69.33%), Postives = 59/75 (78.67%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy Swiss-Prot
Match: Q9SIT9 (Nuclear transcription factor Y subunit B-7 OS=Arabidopsis thaliana OX=3702 GN=NFYB7 PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.0e-21 Identity = 48/84 (57.14%), Postives = 61/84 (72.62%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy Swiss-Prot
Match: Q9FGJ3 (Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana OX=3702 GN=NFYB2 PE=1 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 4.4e-21 Identity = 47/78 (60.26%), Postives = 60/78 (76.92%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy Swiss-Prot
Match: O23310 (Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana OX=3702 GN=NFYB3 PE=1 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.8e-21 Identity = 46/78 (58.97%), Postives = 60/78 (76.92%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy TrEMBL
Match: A0A6J1HUN8 (nuclear transcription factor Y subunit B-4-like OS=Cucurbita maxima OX=3661 GN=LOC111467987 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 2.3e-33 Identity = 74/88 (84.09%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy TrEMBL
Match: A0A6J1HDY6 (nuclear transcription factor Y subunit B-4-like OS=Cucurbita moschata OX=3662 GN=LOC111461996 PE=3 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 2.3e-33 Identity = 74/88 (84.09%), Postives = 80/88 (90.91%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy TrEMBL
Match: A0A6J1CXT8 (nuclear transcription factor Y subunit B-4-like OS=Momordica charantia OX=3673 GN=LOC111015264 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 7.1e-30 Identity = 66/85 (77.65%), Postives = 77/85 (90.59%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy TrEMBL
Match: A0A6A1UNL9 (Nuclear transcription factor Y subunit B-4 OS=Morella rubra OX=262757 GN=CJ030_MR0G003693 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 5.1e-28 Identity = 64/88 (72.73%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of Spg028195 vs. ExPASy TrEMBL
Match: A0A067JU24 (CBFD_NFYB_HMF domain-containing protein OS=Jatropha curcas OX=180498 GN=JCGZ_23333 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 6.6e-28 Identity = 63/87 (72.41%), Postives = 74/87 (85.06%), Query Frame = 0
BLAST of Spg028195 vs. TAIR 10
Match: AT1G09030.1 (nuclear factor Y, subunit B4 ) HSP 1 Score: 119.4 bits (298), Expect = 1.5e-27 Identity = 56/84 (66.67%), Postives = 70/84 (83.33%), Query Frame = 0
BLAST of Spg028195 vs. TAIR 10
Match: AT2G47810.1 (nuclear factor Y, subunit B5 ) HSP 1 Score: 110.2 bits (274), Expect = 8.8e-25 Identity = 52/75 (69.33%), Postives = 59/75 (78.67%), Query Frame = 0
BLAST of Spg028195 vs. TAIR 10
Match: AT2G13570.1 (nuclear factor Y, subunit B7 ) HSP 1 Score: 102.8 bits (255), Expect = 1.4e-22 Identity = 48/84 (57.14%), Postives = 61/84 (72.62%), Query Frame = 0
BLAST of Spg028195 vs. TAIR 10
Match: AT5G47640.1 (nuclear factor Y, subunit B2 ) HSP 1 Score: 101.7 bits (252), Expect = 3.1e-22 Identity = 47/78 (60.26%), Postives = 60/78 (76.92%), Query Frame = 0
BLAST of Spg028195 vs. TAIR 10
Match: AT4G14540.1 (nuclear factor Y, subunit B3 ) HSP 1 Score: 101.3 bits (251), Expect = 4.1e-22 Identity = 46/78 (58.97%), Postives = 60/78 (76.92%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|