
Spg022844 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTTGTTGCACAAATTCAGGAATTGCTAGAGGATGTGGTTGGCAGAAAATAGGTGCATATATCAACTTGGCTTCTTTTTACTTAGTGGGAATTCCTTGTTCCATATCTTTAGCTTTTGTGTTGGACATGAAAGGGAAGGTAGAAATCTTGTCTCTCTCATCAACTTTTCACTTTCATTTGACATTTCCATGTTTGAATCTTTGAACTCTGTTTCTTCTGCAGGGACTCTGGTTGGGCGTTGTATCTGCTTTTCTAGTGCAAGTGGTGTTCTTTCTTGTAATGACAGTTCGCACAAACTGGGACAAACAGGTGAGCCTTGAGCAATGTTTTAGTGCTTAA ATGTTTTGTTGCACAAATTCAGGAATTGCTAGAGGATGTGGTTGGCAGAAAATAGGTGCATATATCAACTTGGCTTCTTTTTACTTAGTGGGAATTCCTTGTTCCATATCTTTAGCTTTTGTGTTGGACATGAAAGGGAAGGGACTCTGGTTGGGCGTTGTATCTGCTTTTCTAGTGCAAGTGGTGTTCTTTCTTGTAATGACAGTTCGCACAAACTGGGACAAACAGGTGAGCCTTGAGCAATGTTTTAGTGCTTAA ATGTTTTGTTGCACAAATTCAGGAATTGCTAGAGGATGTGGTTGGCAGAAAATAGGTGCATATATCAACTTGGCTTCTTTTTACTTAGTGGGAATTCCTTGTTCCATATCTTTAGCTTTTGTGTTGGACATGAAAGGGAAGGGACTCTGGTTGGGCGTTGTATCTGCTTTTCTAGTGCAAGTGGTGTTCTTTCTTGTAATGACAGTTCGCACAAACTGGGACAAACAGGTGAGCCTTGAGCAATGTTTTAGTGCTTAA MFCCTNSGIARGCGWQKIGAYINLASFYLVGIPCSISLAFVLDMKGKGLWLGVVSAFLVQVVFFLVMTVRTNWDKQVSLEQCFSA Homology
BLAST of Spg022844 vs. NCBI nr
Match: XP_023515398.1 (protein DETOXIFICATION 16-like isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 146.7 bits (369), Expect = 8.8e-32 Identity = 69/76 (90.79%), Postives = 74/76 (97.37%), Query Frame = 0
BLAST of Spg022844 vs. NCBI nr
Match: XP_023515400.1 (protein DETOXIFICATION 16-like isoform X3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 146.7 bits (369), Expect = 8.8e-32 Identity = 69/76 (90.79%), Postives = 74/76 (97.37%), Query Frame = 0
BLAST of Spg022844 vs. NCBI nr
Match: XP_023515399.1 (protein DETOXIFICATION 16-like isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 137.9 bits (346), Expect = 4.1e-29 Identity = 65/70 (92.86%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Spg022844 vs. NCBI nr
Match: KAG6589623.1 (Protein DETOXIFICATION 16, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 135.6 bits (340), Expect = 2.0e-28 Identity = 64/70 (91.43%), Postives = 69/70 (98.57%), Query Frame = 0
BLAST of Spg022844 vs. NCBI nr
Match: TKY61034.1 (MATE efflux family protein 6 [Spatholobus suberectus]) HSP 1 Score: 116.3 bits (290), Expect = 1.3e-22 Identity = 49/75 (65.33%), Postives = 64/75 (85.33%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy Swiss-Prot
Match: Q9C9U1 (Protein DETOXIFICATION 17 OS=Arabidopsis thaliana OX=3702 GN=DTX17 PE=2 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 4.0e-19 Identity = 41/73 (56.16%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy Swiss-Prot
Match: Q9FHB6 (Protein DETOXIFICATION 16 OS=Arabidopsis thaliana OX=3702 GN=DTX16 PE=2 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 8.9e-19 Identity = 41/73 (56.16%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy Swiss-Prot
Match: F4IHU9 (Protein DETOXIFICATION 15 OS=Arabidopsis thaliana OX=3702 GN=DTX15 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.8e-18 Identity = 39/71 (54.93%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy Swiss-Prot
Match: Q8L731 (Protein DETOXIFICATION 12 OS=Arabidopsis thaliana OX=3702 GN=DTX12 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 8.3e-17 Identity = 39/70 (55.71%), Postives = 52/70 (74.29%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy Swiss-Prot
Match: Q94AL1 (Protein DETOXIFICATION 13 OS=Arabidopsis thaliana OX=3702 GN=DTX13 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 8.3e-17 Identity = 39/70 (55.71%), Postives = 52/70 (74.29%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy TrEMBL
Match: A0A444ZU19 (Protein DETOXIFICATION OS=Arachis hypogaea OX=3818 GN=Ahy_B03g062408 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.4e-22 Identity = 47/75 (62.67%), Postives = 63/75 (84.00%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy TrEMBL
Match: A0A445DND8 (Protein DETOXIFICATION OS=Arachis hypogaea OX=3818 GN=Ahy_A03g010756 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.4e-22 Identity = 47/75 (62.67%), Postives = 63/75 (84.00%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy TrEMBL
Match: A0A6P4D0P0 (Protein DETOXIFICATION OS=Arachis duranensis OX=130453 GN=LOC107481614 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.4e-22 Identity = 47/75 (62.67%), Postives = 63/75 (84.00%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy TrEMBL
Match: A0A1J7H1A7 (Protein DETOXIFICATION OS=Lupinus angustifolius OX=3871 GN=TanjilG_03612 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 2.4e-22 Identity = 48/77 (62.34%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of Spg022844 vs. ExPASy TrEMBL
Match: A0A151T362 (Protein DETOXIFICATION OS=Cajanus cajan OX=3821 GN=KK1_015958 PE=3 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 3.1e-22 Identity = 49/72 (68.06%), Postives = 63/72 (87.50%), Query Frame = 0
BLAST of Spg022844 vs. TAIR 10
Match: AT1G73700.1 (MATE efflux family protein ) HSP 1 Score: 95.1 bits (235), Expect = 2.8e-20 Identity = 41/73 (56.16%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Spg022844 vs. TAIR 10
Match: AT5G52450.1 (MATE efflux family protein ) HSP 1 Score: 94.0 bits (232), Expect = 6.3e-20 Identity = 41/73 (56.16%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Spg022844 vs. TAIR 10
Match: AT2G34360.1 (MATE efflux family protein ) HSP 1 Score: 91.3 bits (225), Expect = 4.1e-19 Identity = 39/71 (54.93%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of Spg022844 vs. TAIR 10
Match: AT1G15180.1 (MATE efflux family protein ) HSP 1 Score: 87.4 bits (215), Expect = 5.9e-18 Identity = 39/70 (55.71%), Postives = 52/70 (74.29%), Query Frame = 0
BLAST of Spg022844 vs. TAIR 10
Match: AT1G15170.1 (MATE efflux family protein ) HSP 1 Score: 87.4 bits (215), Expect = 5.9e-18 Identity = 39/70 (55.71%), Postives = 52/70 (74.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|