Spg017782 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.TCCCCTTCGCTCCTAAAGATCGCTCAAGGGCATCCAATGGTAAGGGTCTCATTTCAATATACGTGTAAATATGGGTGAGCTTATAGCACCTCAACTAAGTTCAAGAGAGAGACTTAAATTTGATCGTCAAGAAACTTAAAGATTTTATATCTAGATAGGGGGCCTCAATATGTAATGCATAATAGGTTGCATTCTGCTTAAACCCTTCCTTCGAGTTTGTTTTTTTGTAGTATGCCATTTTATTCTTTCATAAATGAAATTTCGGTTTCTTACCAAAATAATAATAACAACAACAGCAACAACTTTCATGTTAGGAATTTGCTTTTGAATTTATTTCAAGAATGTAAAATTCGTTGTTGCAACAGTTGGTGGAACTGAAAAATGGTGAGACTTACAACGGCCATTTGGTTAATTGTGATACATGGATGAACATTCATCTCCGGGAAGTCATCTGCACTTCCAAAGTAATGAACTTTTATTTCAGTGATGAATTTTTCTCTTTTTCATTTGCTTTTACTTTTTATGAGAGAATGGGTAACAGTTTTCTATATCAAATGTAGGATTTGGCGGATGTCTGA TCCCCTTCGCTCCTAAAGATCGCTCAAGGGCATCCAATGTTGGTGGAACTGAAAAATGGTGAGACTTACAACGGCCATTTGGTTAATTGTGATACATGGATGAACATTCATCTCCGGGAAGTCATCTGCACTTCCAAAGATTTGGCGGATGTCTGA TCCCCTTCGCTCCTAAAGATCGCTCAAGGGCATCCAATGTTGGTGGAACTGAAAAATGGTGAGACTTACAACGGCCATTTGGTTAATTGTGATACATGGATGAACATTCATCTCCGGGAAGTCATCTGCACTTCCAAAGATTTGGCGGATGTCTGA SPSLLKIAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDLADV Homology
BLAST of Spg017782 vs. NCBI nr
Match: XP_022770923.1 (probable U6 snRNA-associated Sm-like protein LSm4 isoform X1 [Durio zibethinus] >XP_022770924.1 probable U6 snRNA-associated Sm-like protein LSm4 isoform X1 [Durio zibethinus]) HSP 1 Score: 99.8 bits (247), Expect = 7.4e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. NCBI nr
Match: XP_039129750.1 (probable U6 snRNA-associated Sm-like protein LSm4 [Dioscorea cayenensis subsp. rotundata]) HSP 1 Score: 99.8 bits (247), Expect = 7.4e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. NCBI nr
Match: KAF2315001.1 (hypothetical protein GH714_037497 [Hevea brasiliensis]) HSP 1 Score: 99.8 bits (247), Expect = 7.4e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. NCBI nr
Match: XP_002283804.1 (PREDICTED: probable U6 snRNA-associated Sm-like protein LSm4 [Vitis vinifera]) HSP 1 Score: 99.8 bits (247), Expect = 7.4e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. NCBI nr
Match: XP_022926288.1 (sm-like protein LSM4 isoform X1 [Cucurbita moschata] >XP_022981642.1 sm-like protein LSM4 isoform X1 [Cucurbita maxima] >XP_022981643.1 sm-like protein LSM4 isoform X1 [Cucurbita maxima] >XP_023523329.1 sm-like protein LSM4 isoform X1 [Cucurbita pepo subsp. pepo] >KAG7037244.1 hypothetical protein SDJN02_00867 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 99.8 bits (247), Expect = 7.4e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy Swiss-Prot
Match: F4K4E3 (Sm-like protein LSM4 OS=Arabidopsis thaliana OX=3702 GN=LSM4 PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 9.7e-21 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy Swiss-Prot
Match: Q9LGE6 (Probable U6 snRNA-associated Sm-like protein LSm4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0256900 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 9.7e-21 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy Swiss-Prot
Match: Q43582 (Probable U6 snRNA-associated Sm-like protein LSm4 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 9.7e-21 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy Swiss-Prot
Match: Q9ZRU9 (Probable U6 snRNA-associated Sm-like protein LSm4 OS=Fagus sylvatica OX=28930 GN=LSM4 PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 3.7e-20 Identity = 43/45 (95.56%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy Swiss-Prot
Match: Q3ZBK6 (U6 snRNA-associated Sm-like protein LSm4 OS=Bos taurus OX=9913 GN=LSM4 PE=2 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.0e-17 Identity = 39/45 (86.67%), Postives = 42/45 (93.33%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy TrEMBL
Match: A0A2G9IAA6 (U6 snRNA-associated Sm-like protein LSm4 OS=Handroanthus impetiginosus OX=429701 GN=LSM4 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 3.6e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy TrEMBL
Match: A0A5D2E990 (U6 snRNA-associated Sm-like protein LSm4 OS=Gossypium darwinii OX=34276 GN=LSM4 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 3.6e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy TrEMBL
Match: A0A059A9J1 (U6 snRNA-associated Sm-like protein LSm4 OS=Eucalyptus grandis OX=71139 GN=LSM4 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 3.6e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy TrEMBL
Match: A0A1U7WYS5 (U6 snRNA-associated Sm-like protein LSm4 OS=Nicotiana sylvestris OX=4096 GN=LOC104231212 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 3.6e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. ExPASy TrEMBL
Match: A0A1U8KMG3 (U6 snRNA-associated Sm-like protein LSm4 OS=Gossypium hirsutum OX=3635 GN=LOC107917334 PE=3 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 3.6e-18 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. TAIR 10
Match: AT5G27720.1 (Small nuclear ribonucleoprotein family protein ) HSP 1 Score: 99.8 bits (247), Expect = 6.9e-22 Identity = 44/45 (97.78%), Postives = 44/45 (97.78%), Query Frame = 0
BLAST of Spg017782 vs. TAIR 10
Match: AT1G20580.1 (Small nuclear ribonucleoprotein family protein ) HSP 1 Score: 44.7 bits (104), Expect = 2.6e-05 Identity = 19/44 (43.18%), Postives = 27/44 (61.36%), Query Frame = 0
BLAST of Spg017782 vs. TAIR 10
Match: AT1G76300.1 (snRNP core protein SMD3 ) HSP 1 Score: 41.6 bits (96), Expect = 2.2e-04 Identity = 17/44 (38.64%), Postives = 26/44 (59.09%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|