![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Spg013399 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACTTGGAAGACTGATAATAATAAGAAATTCAGGGACTCCCGATAATTTAATCAGGAACTTAGCAACAAATTGATGATCGAATTAATCTCTCGTCCACGTAAAAGCCGAACATTTTTCCTTTTAATGGATTAATGGATAACGCTCGTTAGAATAAGAATTTGAATTCTCTTCACCACTCAAATTTGGAAGCAGTAGCCGCCATAGCCAAAAGGGGATGGAGGACAAGGAGAAGAAGGGGCTAGAAGGCACTGGTTTAGATCTTCCAGTCAATCGCCATGGTAACTTGAAGAGTGCTTCTAGCGATCAAGATTTCAAGGATGTTCTTCTTCAAATCAAGTCCTCCAAAACCACTGTAAACTTCTTTATACTTAATAAATTTTGTTTCCCATTCCCCTAAATCGCTGTCCTCGTGTTATTTCATGGGCTGTTTGGTTTCTTGGAAAATTGTGTAAACTCGAATGGGATGAAGATTTCAAGTTACGGGTTTTTGGTTCTTTCTGTGCTGTAACTGGTTTTGGAAGATTGATTGTTTGATTCTATTGTTCAATACTTTGCAGGCAGTTATCAAATATGGTGCATCCTGGTAAGTCCACACTTTTCTTTAGCGGATTGAACGCAAGGTGTTTGAGGTTTTGCCTGTATGAGAAATGCTGAAAGACTAGAATAACAAACGCCTTTCTCTCTCTCTCAACAACATAGGTGATTGGTTTGTTTCATAGCTGATGAATTTAAATATGCCATCTCTTGCTTCAATTTCATTTCACCATTCGTCACTGTTCTTAGCAACACTTTCATAATGGGGAATTGTAAAATTTGTTCCCACTGGTCATTGCTGGACTAATGTTAAAAAGAACTTACCAGCAAAGCTCTGCATTACCATTTCAGTGAGGTAGTTGATAGAATCTGGTGCTCAAATTGAGTTGAGAGAAAACATAATCTGGTGCTAAAATTAAACCTCAGTTTCTTGTTTTAAGAGCTCATGGATTGCTTTTGTGATATCAGAACCTGCAGGGCTTAGAGGGATTGTTGTTGTTCGTTTCAGGTGTCGTGTGTGCAGTCAGATTCTCCCTGCTTTCTGTCGGCTGAGTAACAATTTTCCAAAGGTTTCTTTCATCTATGCAGATATTGATGAATGCCCAGAAACAACTGAACACATCCGCTACACACCGACATTTCAATTCTATCGAGACGGTGAAAGAGTCGACGAGATGTTTGGTGCCGGGGAAGAACGGCTGCACGACAGGTTGTGGTTGCATTCCTAA ATGGAGGACAAGGAGAAGAAGGGGCTAGAAGGCACTGGTTTAGATCTTCCAGTCAATCGCCATGGTAACTTGAAGAGTGCTTCTAGCGATCAAGATTTCAAGGATGTTCTTCTTCAAATCAAGTCCTCCAAAACCACTGCAGTTATCAAATATGGTGCATCCTGCAAAGCTCTGCATTACCATTTCAGTGAGAGCTCATGGATTGCTTTTGTGATATCAGAACCTGCAGGGCTTAGAGGGATTGTTGTTGTTCGTTTCAGGTGTCGTGTGTGCAGTCAGATTCTCCCTGCTTTCTGTCGGCTGAGTAACAATTTTCCAAAGGTTTCTTTCATCTATGCAGATATTGATGAATGCCCAGAAACAACTGAACACATCCGCTACACACCGACATTTCAATTCTATCGAGACGGTGAAAGAGTCGACGAGATGTTTGGTGCCGGGGAAGAACGGCTGCACGACAGGTTGTGGTTGCATTCCTAA ATGGAGGACAAGGAGAAGAAGGGGCTAGAAGGCACTGGTTTAGATCTTCCAGTCAATCGCCATGGTAACTTGAAGAGTGCTTCTAGCGATCAAGATTTCAAGGATGTTCTTCTTCAAATCAAGTCCTCCAAAACCACTGCAGTTATCAAATATGGTGCATCCTGCAAAGCTCTGCATTACCATTTCAGTGAGAGCTCATGGATTGCTTTTGTGATATCAGAACCTGCAGGGCTTAGAGGGATTGTTGTTGTTCGTTTCAGGTGTCGTGTGTGCAGTCAGATTCTCCCTGCTTTCTGTCGGCTGAGTAACAATTTTCCAAAGGTTTCTTTCATCTATGCAGATATTGATGAATGCCCAGAAACAACTGAACACATCCGCTACACACCGACATTTCAATTCTATCGAGACGGTGAAAGAGTCGACGAGATGTTTGGTGCCGGGGAAGAACGGCTGCACGACAGGTTGTGGTTGCATTCCTAA MEDKEKKGLEGTGLDLPVNRHGNLKSASSDQDFKDVLLQIKSSKTTAVIKYGASCKALHYHFSESSWIAFVISEPAGLRGIVVVRFRCRVCSQILPAFCRLSNNFPKVSFIYADIDECPETTEHIRYTPTFQFYRDGERVDEMFGAGEERLHDRLWLHS Homology
BLAST of Spg013399 vs. NCBI nr
Match: XP_022143884.1 (thioredoxin-like 3-3 [Momordica charantia]) HSP 1 Score: 236.9 bits (603), Expect = 1.2e-58 Identity = 121/159 (76.10%), Postives = 123/159 (77.36%), Query Frame = 0
BLAST of Spg013399 vs. NCBI nr
Match: XP_008462474.1 (PREDICTED: thioredoxin-like 3-3 [Cucumis melo] >XP_008462475.1 PREDICTED: thioredoxin-like 3-3 [Cucumis melo] >XP_008462476.1 PREDICTED: thioredoxin-like 3-3 [Cucumis melo] >XP_008462478.1 PREDICTED: thioredoxin-like 3-3 [Cucumis melo] >TYK07313.1 thioredoxin-like 3-3 [Cucumis melo var. makuwa]) HSP 1 Score: 235.0 bits (598), Expect = 4.6e-58 Identity = 121/159 (76.10%), Postives = 122/159 (76.73%), Query Frame = 0
BLAST of Spg013399 vs. NCBI nr
Match: XP_011657665.1 (thioredoxin-like 3-3 [Cucumis sativus] >XP_031742982.1 thioredoxin-like 3-3 [Cucumis sativus] >KGN48189.1 hypothetical protein Csa_003651 [Cucumis sativus]) HSP 1 Score: 234.6 bits (597), Expect = 6.0e-58 Identity = 121/159 (76.10%), Postives = 122/159 (76.73%), Query Frame = 0
BLAST of Spg013399 vs. NCBI nr
Match: XP_022963258.1 (thioredoxin-like 3-3 [Cucurbita moschata] >XP_022963259.1 thioredoxin-like 3-3 [Cucurbita moschata] >XP_022963260.1 thioredoxin-like 3-3 [Cucurbita moschata] >XP_022963261.1 thioredoxin-like 3-3 [Cucurbita moschata]) HSP 1 Score: 234.6 bits (597), Expect = 6.0e-58 Identity = 121/159 (76.10%), Postives = 121/159 (76.10%), Query Frame = 0
BLAST of Spg013399 vs. NCBI nr
Match: XP_022972722.1 (thioredoxin-like 3-3 [Cucurbita maxima] >XP_022972723.1 thioredoxin-like 3-3 [Cucurbita maxima] >XP_022972724.1 thioredoxin-like 3-3 [Cucurbita maxima] >XP_022972725.1 thioredoxin-like 3-3 [Cucurbita maxima] >XP_023518471.1 thioredoxin-like 3-3 [Cucurbita pepo subsp. pepo] >XP_023518472.1 thioredoxin-like 3-3 [Cucurbita pepo subsp. pepo] >XP_023518473.1 thioredoxin-like 3-3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 232.6 bits (592), Expect = 2.3e-57 Identity = 120/159 (75.47%), Postives = 121/159 (76.10%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy Swiss-Prot
Match: Q7XSQ7 (Thioredoxin-like 3-3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560200 PE=2 SV=2) HSP 1 Score: 180.6 bits (457), Expect = 1.4e-44 Identity = 92/157 (58.60%), Postives = 104/157 (66.24%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy Swiss-Prot
Match: Q8LCH9 (Thioredoxin-like 3-3 OS=Arabidopsis thaliana OX=3702 GN=At3g53220 PE=2 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 6.5e-39 Identity = 87/156 (55.77%), Postives = 100/156 (64.10%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy Swiss-Prot
Match: P85801 (Thioredoxin H-type OS=Populus jackii OX=640484 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 1.1e-09 Identity = 33/89 (37.08%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy Swiss-Prot
Match: O43396 (Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3) HSP 1 Score: 59.3 bits (142), Expect = 4.5e-08 Identity = 33/88 (37.50%), Postives = 50/88 (56.82%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy Swiss-Prot
Match: Q8CDN6 (Thioredoxin-like protein 1 OS=Mus musculus OX=10090 GN=Txnl1 PE=1 SV=3) HSP 1 Score: 59.3 bits (142), Expect = 4.5e-08 Identity = 33/88 (37.50%), Postives = 50/88 (56.82%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy TrEMBL
Match: A0A6J1CQN4 (thioredoxin-like 3-3 OS=Momordica charantia OX=3673 GN=LOC111013691 PE=4 SV=1) HSP 1 Score: 236.9 bits (603), Expect = 5.9e-59 Identity = 121/159 (76.10%), Postives = 123/159 (77.36%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy TrEMBL
Match: A0A1S3CH29 (thioredoxin-like 3-3 OS=Cucumis melo OX=3656 GN=LOC103500822 PE=4 SV=1) HSP 1 Score: 235.0 bits (598), Expect = 2.2e-58 Identity = 121/159 (76.10%), Postives = 122/159 (76.73%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy TrEMBL
Match: A0A5D3C5X7 (Thioredoxin-like 3-3 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold202G00280 PE=4 SV=1) HSP 1 Score: 235.0 bits (598), Expect = 2.2e-58 Identity = 121/159 (76.10%), Postives = 122/159 (76.73%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy TrEMBL
Match: A0A6J1HH85 (thioredoxin-like 3-3 OS=Cucurbita moschata OX=3662 GN=LOC111463526 PE=4 SV=1) HSP 1 Score: 234.6 bits (597), Expect = 2.9e-58 Identity = 121/159 (76.10%), Postives = 121/159 (76.10%), Query Frame = 0
BLAST of Spg013399 vs. ExPASy TrEMBL
Match: A0A0A0KH96 (Thioredoxin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G446490 PE=4 SV=1) HSP 1 Score: 234.6 bits (597), Expect = 2.9e-58 Identity = 121/159 (76.10%), Postives = 122/159 (76.73%), Query Frame = 0
BLAST of Spg013399 vs. TAIR 10
Match: AT3G53220.1 (Thioredoxin superfamily protein ) HSP 1 Score: 161.8 bits (408), Expect = 4.6e-40 Identity = 87/156 (55.77%), Postives = 100/156 (64.10%), Query Frame = 0
BLAST of Spg013399 vs. TAIR 10
Match: AT3G17880.1 (tetraticopeptide domain-containing thioredoxin ) HSP 1 Score: 48.1 bits (113), Expect = 7.4e-06 Identity = 24/74 (32.43%), Postives = 38/74 (51.35%), Query Frame = 0
BLAST of Spg013399 vs. TAIR 10
Match: AT3G17880.2 (tetraticopeptide domain-containing thioredoxin ) HSP 1 Score: 48.1 bits (113), Expect = 7.4e-06 Identity = 24/74 (32.43%), Postives = 38/74 (51.35%), Query Frame = 0
BLAST of Spg013399 vs. TAIR 10
Match: AT2G42580.1 (tetratricopetide-repeat thioredoxin-like 3 ) HSP 1 Score: 46.2 bits (108), Expect = 2.8e-05 Identity = 27/83 (32.53%), Postives = 40/83 (48.19%), Query Frame = 0
BLAST of Spg013399 vs. TAIR 10
Match: AT3G51030.1 (thioredoxin H-type 1 ) HSP 1 Score: 46.2 bits (108), Expect = 2.8e-05 Identity = 27/83 (32.53%), Postives = 40/83 (48.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
|