![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Spg000404 (gene) Sponge gourd (cylindrica) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAGACGAAGAAACAGCCGCAACAACAACAACAACAGCAACAGAAGCAGATTCCGGCGACACAGAACGACCCCGCCTTTCAATTTTCCGACGACGACGACGACGACGGCGGCTGCAGCACTCCAAAAGCAGAGAGATTCAGAATCCCGGAGATTCTGACGTGTCCACCGGCGCCGAAGAAGCAAAGAGCCGTTTCCGATTGCTCATTCCGGCGATCGCCAATTGCCTTTTTTGCCCCTCCAGAATTAGAGCTCTTCTTCTTCGTCGCTCTGCCGAACATTTCAGTCTGAAGCTCAAAGCTAATCAAGGCTCGTGTGTTTATACAAATTTTACAGACACATCAAAAAAAAAAAAAAAAAAAAAAAATACCAAGTTCTTATTTTTCTCCTCTTTTTTTGTTAGATATTAGTTTGAATAAGTTTGGCTTTCCTTTTTTTTGTGTGAGAATTTGAGCTTGGAGATGCAGAATTTGAAATTGGGTTTGCTCTGTAATATTATTATCAATATAATTTTTTCTTTTTTTTGGATTGGGGAATTTTGAAGAACTGTGTAATGTTTGTCCCACAACTTTCCCTTGTGATAATTTGAAGCAATGGGTCACTTTATTTTGAAGTGTAATGAAATGGGTCAATGGTGGGAGCCATTTTTTATGGTGCTCTGTTTAAAAAGCTTGAGACTTTCTTTATGGGTTTAGGGTTTTGAAGGTAGTTATGGTTATGGTGCAGATTCCAAGACCAAGGATGAAGAAGAAGAAGAAGATGATGAGTAA ATGAAGAAGACGAAGAAACAGCCGCAACAACAACAACAACAGCAACAGAAGCAGATTCCGGCGACACAGAACGACCCCGCCTTTCAATTTTCCGACGACGACGACGACGACGGCGGCTGCAGCACTCCAAAAGCAGAGAGATTCAGAATCCCGGAGATTCTGACGTGTCCACCGGCGCCGAAGAAGCAAAGAGCCGTTTCCGATTGCTCATTCCGGCGATCGCCAATTGCCTTTTTTGCCCCTCCAGAATTAGAGCTCTTCTTCTTCGTCGCTCTGCCGAACATTTCAGGTTTTGAAGGTAGTTATGGTTATGGTGCAGATTCCAAGACCAAGGATGAAGAAGAAGAAGAAGATGATGAGTAA ATGAAGAAGACGAAGAAACAGCCGCAACAACAACAACAACAGCAACAGAAGCAGATTCCGGCGACACAGAACGACCCCGCCTTTCAATTTTCCGACGACGACGACGACGACGGCGGCTGCAGCACTCCAAAAGCAGAGAGATTCAGAATCCCGGAGATTCTGACGTGTCCACCGGCGCCGAAGAAGCAAAGAGCCGTTTCCGATTGCTCATTCCGGCGATCGCCAATTGCCTTTTTTGCCCCTCCAGAATTAGAGCTCTTCTTCTTCGTCGCTCTGCCGAACATTTCAGGTTTTGAAGGTAGTTATGGTTATGGTGCAGATTCCAAGACCAAGGATGAAGAAGAAGAAGAAGATGATGAGTAA MKKTKKQPQQQQQQQQKQIPATQNDPAFQFSDDDDDDGGCSTPKAERFRIPEILTCPPAPKKQRAVSDCSFRRSPIAFFAPPELELFFFVALPNISGFEGSYGYGADSKTKDEEEEEDDE Homology
BLAST of Spg000404 vs. NCBI nr
Match: XP_038902266.1 (cyclin-dependent protein kinase inhibitor SMR13 [Benincasa hispida]) HSP 1 Score: 131.0 bits (328), Expect = 7.1e-27 Identity = 71/94 (75.53%), Postives = 79/94 (84.04%), Query Frame = 0
BLAST of Spg000404 vs. NCBI nr
Match: XP_022148810.1 (cyclin-dependent protein kinase inhibitor SMR15-like [Momordica charantia]) HSP 1 Score: 130.2 bits (326), Expect = 1.2e-26 Identity = 73/95 (76.84%), Postives = 79/95 (83.16%), Query Frame = 0
BLAST of Spg000404 vs. NCBI nr
Match: KAG7035865.1 (Cyclin-dependent protein kinase inhibitor SMR13, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 128.6 bits (322), Expect = 3.5e-26 Identity = 72/99 (72.73%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Spg000404 vs. NCBI nr
Match: KAG6605917.1 (Cyclin-dependent protein kinase inhibitor SMR13, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 127.1 bits (318), Expect = 1.0e-25 Identity = 71/96 (73.96%), Postives = 76/96 (79.17%), Query Frame = 0
BLAST of Spg000404 vs. NCBI nr
Match: XP_022996084.1 (cyclin-dependent protein kinase inhibitor SMR9-like [Cucurbita maxima]) HSP 1 Score: 125.2 bits (313), Expect = 3.9e-25 Identity = 71/99 (71.72%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy Swiss-Prot
Match: F4IWB3 (Cyclin-dependent protein kinase inhibitor SMR13 OS=Arabidopsis thaliana OX=3702 GN=SMR13 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 2.9e-15 Identity = 36/51 (70.59%), Postives = 41/51 (80.39%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy Swiss-Prot
Match: Q3ECS5 (Cyclin-dependent protein kinase inhibitor SMR9 OS=Arabidopsis thaliana OX=3702 GN=SMR9 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.2e-13 Identity = 35/56 (62.50%), Postives = 43/56 (76.79%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy Swiss-Prot
Match: Q1G3Y4 (Cyclin-dependent protein kinase inhibitor SMR15 OS=Arabidopsis thaliana OX=3702 GN=SMR15 PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 1.2e-05 Identity = 25/58 (43.10%), Postives = 37/58 (63.79%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy Swiss-Prot
Match: Q9LNX4 (Cyclin-dependent protein kinase inhibitor SMR5 OS=Arabidopsis thaliana OX=3702 GN=SMR5 PE=1 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 1.0e-04 Identity = 24/60 (40.00%), Postives = 35/60 (58.33%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy Swiss-Prot
Match: Q9SAD3 (Cyclin-dependent protein kinase inhibitor SMR8 OS=Arabidopsis thaliana OX=3702 GN=SMR8 PE=1 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 5.1e-04 Identity = 22/63 (34.92%), Postives = 34/63 (53.97%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy TrEMBL
Match: A0A6J1D3Z6 (cyclin-dependent protein kinase inhibitor SMR15-like OS=Momordica charantia OX=3673 GN=LOC111017372 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 5.8e-27 Identity = 73/95 (76.84%), Postives = 79/95 (83.16%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy TrEMBL
Match: A0A6J1K7R4 (cyclin-dependent protein kinase inhibitor SMR9-like OS=Cucurbita maxima OX=3661 GN=LOC111491400 PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 1.9e-25 Identity = 71/99 (71.72%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy TrEMBL
Match: A0A6J1JET4 (cyclin-dependent protein kinase inhibitor SMR13 OS=Cucurbita maxima OX=3661 GN=LOC111484378 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 3.2e-25 Identity = 73/98 (74.49%), Postives = 80/98 (81.63%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy TrEMBL
Match: A0A6J1FTJ6 (cyclin-dependent protein kinase inhibitor SMR13 OS=Cucurbita moschata OX=3662 GN=LOC111448665 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 7.1e-25 Identity = 72/98 (73.47%), Postives = 80/98 (81.63%), Query Frame = 0
BLAST of Spg000404 vs. ExPASy TrEMBL
Match: A0A6J1H2X7 (cyclin-dependent protein kinase inhibitor SMR13-like OS=Cucurbita moschata OX=3662 GN=LOC111459621 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 3.0e-23 Identity = 67/95 (70.53%), Postives = 73/95 (76.84%), Query Frame = 0
BLAST of Spg000404 vs. TAIR 10
Match: AT3G20898.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G51355.1); Has 66 Blast hits to 66 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 66; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 82.8 bits (203), Expect = 2.1e-16 Identity = 36/51 (70.59%), Postives = 41/51 (80.39%), Query Frame = 0
BLAST of Spg000404 vs. TAIR 10
Match: AT1G51355.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G20898.1); Has 52 Blast hits to 52 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 2; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 77.4 bits (189), Expect = 8.7e-15 Identity = 35/56 (62.50%), Postives = 43/56 (76.79%), Query Frame = 0
BLAST of Spg000404 vs. TAIR 10
Match: AT1G60783.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G10690.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 50.8 bits (120), Expect = 8.7e-07 Identity = 25/58 (43.10%), Postives = 37/58 (63.79%), Query Frame = 0
BLAST of Spg000404 vs. TAIR 10
Match: AT1G10690.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G60783.1); Has 59 Blast hits to 59 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 59; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 45.4 bits (106), Expect = 3.6e-05 Identity = 22/63 (34.92%), Postives = 34/63 (53.97%), Query Frame = 0
BLAST of Spg000404 vs. TAIR 10
Match: AT5G02220.1 (unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 43.9 bits (102), Expect = 1.1e-04 Identity = 21/53 (39.62%), Postives = 31/53 (58.49%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (cylindrica) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|