Sgr028580 (gene) Monk fruit (Qingpiguo) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTCATGCAGCAAACAGGCTACAGTTCTGTAGGGAGGACATGAAGGAGATCTTCAGAGAGCACGACCTCGACGGAGATGGTCTCTTGTGCATGAGTGAGCTGGTAAAGGCCTTCGGGTTCCTCGGCAGCATTCTCCCTTTCTACAAGGCTCACTACGGATTGGCTCATGCCGATGCTGATGGAGATGGCTTCATTTGCGAGGACGAGCTCGACAAGCTTGTTGACTTTGCTCAGAGGTTTCAGCACAAGAAGCACTGA ATGTCTCATGCAGCAAACAGGCTACAGTTCTGTAGGGAGGACATGAAGGAGATCTTCAGAGAGCACGACCTCGACGGAGATGGTCTCTTGTGCATGAGTGAGCTGGTAAAGGCCTTCGGGTTCCTCGGCAGCATTCTCCCTTTCTACAAGGCTCACTACGGATTGGCTCATGCCGATGCTGATGGAGATGGCTTCATTTGCGAGGACGAGCTCGACAAGCTTGTTGACTTTGCTCAGAGGTTTCAGCACAAGAAGCACTGA ATGTCTCATGCAGCAAACAGGCTACAGTTCTGTAGGGAGGACATGAAGGAGATCTTCAGAGAGCACGACCTCGACGGAGATGGTCTCTTGTGCATGAGTGAGCTGGTAAAGGCCTTCGGGTTCCTCGGCAGCATTCTCCCTTTCTACAAGGCTCACTACGGATTGGCTCATGCCGATGCTGATGGAGATGGCTTCATTTGCGAGGACGAGCTCGACAAGCTTGTTGACTTTGCTCAGAGGTTTCAGCACAAGAAGCACTGA MSHAANRLQFCREDMKEIFREHDLDGDGLLCMSELVKAFGFLGSILPFYKAHYGLAHADADGDGFICEDELDKLVDFAQRFQHKKH Homology
BLAST of Sgr028580 vs. NCBI nr
Match: KGN62516.1 (hypothetical protein Csa_022521 [Cucumis sativus]) HSP 1 Score: 141.4 bits (355), Expect = 3.8e-30 Identity = 65/85 (76.47%), Postives = 75/85 (88.24%), Query Frame = 0
BLAST of Sgr028580 vs. NCBI nr
Match: KAA0060892.1 (putative calcium-binding protein CML10 [Cucumis melo var. makuwa]) HSP 1 Score: 141.4 bits (355), Expect = 3.8e-30 Identity = 63/85 (74.12%), Postives = 77/85 (90.59%), Query Frame = 0
BLAST of Sgr028580 vs. NCBI nr
Match: XP_004152805.1 (probable calcium-binding protein CML10 [Cucumis sativus]) HSP 1 Score: 135.2 bits (339), Expect = 2.7e-28 Identity = 61/81 (75.31%), Postives = 72/81 (88.89%), Query Frame = 0
BLAST of Sgr028580 vs. NCBI nr
Match: KGN62525.1 (hypothetical protein Csa_022453 [Cucumis sativus]) HSP 1 Score: 121.7 bits (304), Expect = 3.1e-24 Identity = 52/80 (65.00%), Postives = 67/80 (83.75%), Query Frame = 0
BLAST of Sgr028580 vs. NCBI nr
Match: KAA0060886.1 (putative calcium-binding protein CML10 [Cucumis melo var. makuwa]) HSP 1 Score: 118.6 bits (296), Expect = 2.6e-23 Identity = 50/78 (64.10%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of Sgr028580 vs. ExPASy Swiss-Prot
Match: Q8RZB5 (Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica OX=39947 GN=CML10 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.9e-05 Identity = 27/62 (43.55%), Postives = 35/62 (56.45%), Query Frame = 0
BLAST of Sgr028580 vs. ExPASy Swiss-Prot
Match: Q9S744 (Calmodulin-like protein 9 OS=Arabidopsis thaliana OX=3702 GN=CML9 PE=1 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.6e-04 Identity = 22/63 (34.92%), Postives = 36/63 (57.14%), Query Frame = 0
BLAST of Sgr028580 vs. ExPASy Swiss-Prot
Match: Q9SS31 (Probable calcium-binding protein CML36 OS=Arabidopsis thaliana OX=3702 GN=CML36 PE=2 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 6.3e-04 Identity = 22/64 (34.38%), Postives = 33/64 (51.56%), Query Frame = 0
BLAST of Sgr028580 vs. ExPASy TrEMBL
Match: A0A5A7UYC0 (Putative calcium-binding protein CML10 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold501G00250 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.8e-30 Identity = 63/85 (74.12%), Postives = 77/85 (90.59%), Query Frame = 0
BLAST of Sgr028580 vs. ExPASy TrEMBL
Match: A0A0A0LRC1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G358870 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.8e-30 Identity = 65/85 (76.47%), Postives = 75/85 (88.24%), Query Frame = 0
BLAST of Sgr028580 vs. ExPASy TrEMBL
Match: A0A0A0LKX1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G359940 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 1.5e-24 Identity = 52/80 (65.00%), Postives = 67/80 (83.75%), Query Frame = 0
BLAST of Sgr028580 vs. ExPASy TrEMBL
Match: A0A5A7V2Z9 (Putative calcium-binding protein CML10 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold501G00190 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 1.3e-23 Identity = 50/78 (64.10%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of Sgr028580 vs. ExPASy TrEMBL
Match: A0A6J1CSH1 (probable calcium-binding protein CML15 OS=Momordica charantia OX=3673 GN=LOC111013915 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.8e-22 Identity = 51/81 (62.96%), Postives = 65/81 (80.25%), Query Frame = 0
BLAST of Sgr028580 vs. TAIR 10
Match: AT3G51920.1 (calmodulin 9 ) HSP 1 Score: 46.6 bits (109), Expect = 1.2e-05 Identity = 22/63 (34.92%), Postives = 36/63 (57.14%), Query Frame = 0
BLAST of Sgr028580 vs. TAIR 10
Match: AT3G10190.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 44.7 bits (104), Expect = 4.5e-05 Identity = 22/64 (34.38%), Postives = 33/64 (51.56%), Query Frame = 0
BLAST of Sgr028580 vs. TAIR 10
Match: AT2G41410.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 42.4 bits (98), Expect = 2.2e-04 Identity = 21/72 (29.17%), Postives = 38/72 (52.78%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Monk fruit (Qingpiguo) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|