Sgr027502 (gene) Monk fruit (Qingpiguo) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGCCCCGTCGAGGTCTGAAATCCTCTCGCTCTTTCGTTCTCTGCTGCGCACGGCGCGTCAATTCCCAGATTACAACATCAGAGAATACACCAAGCGCCGCACCATTGATGCCTTCCGAGAAAATGGGAGCCTTTCCGACCCTTCTTCGATCTCTTCCGCCTTCGTCGGCGGCAAAGCTCAGCTCGAGGTTGCGAAAAGGCAGGCCCTTGTTTACTCTCTTTACGCGCCTAAGGTCAAGAGTATCATGGACGTCAAGCTCTGA ATGGCGGCCCCGTCGAGGTCTGAAATCCTCTCGCTCTTTCGTTCTCTGCTGCGCACGGCGCGTCAATTCCCAGATTACAACATCAGAGAATACACCAAGCGCCGCACCATTGATGCCTTCCGAGAAAATGGGAGCCTTTCCGACCCTTCTTCGATCTCTTCCGCCTTCGTCGGCGGCAAAGCTCAGCTCGAGGTTGCGAAAAGGCAGGCCCTTGTTTACTCTCTTTACGCGCCTAAGGTCAAGAGTATCATGGACGTCAAGCTCTGA ATGGCGGCCCCGTCGAGGTCTGAAATCCTCTCGCTCTTTCGTTCTCTGCTGCGCACGGCGCGTCAATTCCCAGATTACAACATCAGAGAATACACCAAGCGCCGCACCATTGATGCCTTCCGAGAAAATGGGAGCCTTTCCGACCCTTCTTCGATCTCTTCCGCCTTCGTCGGCGGCAAAGCTCAGCTCGAGGTTGCGAAAAGGCAGGCCCTTGTTTACTCTCTTTACGCGCCTAAGGTCAAGAGTATCATGGACGTCAAGCTCTGA MAAPSRSEILSLFRSLLRTARQFPDYNIREYTKRRTIDAFRENGSLSDPSSISSAFVGGKAQLEVAKRQALVYSLYAPKVKSIMDVKL Homology
BLAST of Sgr027502 vs. NCBI nr
Match: KAG6607477.1 (LYR motif-containing protein 4, partial [Cucurbita argyrosperma subsp. sororia] >KAG7037133.1 LYR motif-containing protein 4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 154.8 bits (390), Expect = 3.4e-34 Identity = 81/86 (94.19%), Postives = 83/86 (96.51%), Query Frame = 0
BLAST of Sgr027502 vs. NCBI nr
Match: XP_022137452.1 (LYR motif-containing protein 4 [Momordica charantia]) HSP 1 Score: 154.1 bits (388), Expect = 5.7e-34 Identity = 82/88 (93.18%), Postives = 83/88 (94.32%), Query Frame = 0
BLAST of Sgr027502 vs. NCBI nr
Match: XP_038894896.1 (LYR motif-containing protein 4 [Benincasa hispida]) HSP 1 Score: 153.7 bits (387), Expect = 7.5e-34 Identity = 81/88 (92.05%), Postives = 83/88 (94.32%), Query Frame = 0
BLAST of Sgr027502 vs. NCBI nr
Match: KGN64034.1 (hypothetical protein Csa_014098 [Cucumis sativus]) HSP 1 Score: 142.5 bits (358), Expect = 1.7e-30 Identity = 74/86 (86.05%), Postives = 79/86 (91.86%), Query Frame = 0
BLAST of Sgr027502 vs. NCBI nr
Match: KAF5807263.1 (putative complex 1 LYR protein [Helianthus annuus]) HSP 1 Score: 139.8 bits (351), Expect = 1.1e-29 Identity = 70/87 (80.46%), Postives = 82/87 (94.25%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy Swiss-Prot
Match: B5FZA8 (LYR motif-containing protein 4 OS=Taeniopygia guttata OX=59729 GN=LYRM4 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-10 Identity = 35/77 (45.45%), Postives = 49/77 (63.64%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy Swiss-Prot
Match: Q9HD34 (LYR motif-containing protein 4 OS=Homo sapiens OX=9606 GN=LYRM4 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.0e-10 Identity = 34/77 (44.16%), Postives = 49/77 (63.64%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy Swiss-Prot
Match: Q8K215 (LYR motif-containing protein 4 OS=Mus musculus OX=10090 GN=Lyrm4 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.0e-09 Identity = 32/77 (41.56%), Postives = 48/77 (62.34%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy Swiss-Prot
Match: Q0VCG0 (LYR motif-containing protein 4 OS=Bos taurus OX=9913 GN=LYRM4 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.6e-09 Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy Swiss-Prot
Match: B5XD90 (LYR motif-containing protein 4B OS=Salmo salar OX=8030 GN=lyrm4b PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.1e-08 Identity = 30/83 (36.14%), Postives = 49/83 (59.04%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy TrEMBL
Match: A0A6J1C8A4 (LYR motif-containing protein 4 OS=Momordica charantia OX=3673 GN=LOC111008892 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 2.8e-34 Identity = 82/88 (93.18%), Postives = 83/88 (94.32%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy TrEMBL
Match: A0A0A0LST7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G039010 PE=4 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 8.3e-31 Identity = 74/86 (86.05%), Postives = 79/86 (91.86%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy TrEMBL
Match: A0A251UU63 (Putative complex 1 LYR protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0157171 PE=4 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 5.4e-30 Identity = 70/87 (80.46%), Postives = 82/87 (94.25%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy TrEMBL
Match: A0A2J6KBZ0 (Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_5X22101 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.1e-29 Identity = 67/84 (79.76%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of Sgr027502 vs. ExPASy TrEMBL
Match: A0A1R3G4H9 (Complex 1 LYR protein OS=Corchorus olitorius OX=93759 GN=COLO4_36893 PE=4 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 7.8e-29 Identity = 68/87 (78.16%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Sgr027502 vs. TAIR 10
Match: AT5G61220.1 (LYR family of Fe/S cluster biogenesis protein ) HSP 1 Score: 100.1 bits (248), Expect = 9.1e-22 Identity = 51/84 (60.71%), Postives = 63/84 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Monk fruit (Qingpiguo) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
|