![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Sgr026732 (gene) Monk fruit (Qingpiguo) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGTCCGCGATCACTACAAGGTTCTGGGCTTGAACAGAAGCGCCACGAAAGAGGAAATCAAGGAGGCATTCAGGAAGCTGGCCATGGAATTTCACCCCGACAAGCATTCCCAATCGCCCAAGGCCGTCAGGGACTCCGCTACTCTGAGATTCAAACAGGTTTCGGAAGCCTATGAGATCCTCGGCGATGATTGCAAGCGTGCTGATTTCAATATTCGCTCTCGTTGCGCCTCTGGCTCCTCTGCTAATCACCATTATTACTCTTCGTATAATTCTTATGCTAATGCAAGTGGACCTCGGTATGCTTCTTCTTCTGGATTTGCCTCTCGCTCTGGTTCCAATGTCGAAGGCTTGGTTACGAATTTTCATATGCTGCTGCGCTTTCTCACTACGCGTGCATTTCTTCTCAATTTTGCTTTCGCCGGGTATTTGTTCTCTACCCTATTTTTCTTGATCGGTACGATTTATGTTTTGAATTCTGATTGCAAATTGCCTCTTCGTACTTTTTTCCATGGTTAA ATGGATGTCCGCGATCACTACAAGGTTCTGGGCTTGAACAGAAGCGCCACGAAAGAGGAAATCAAGGAGGCATTCAGGAAGCTGGCCATGGAATTTCACCCCGACAAGCATTCCCAATCGCCCAAGGCCGTCAGGGACTCCGCTACTCTGAGATTCAAACAGGTTTCGGAAGCCTATGAGATCCTCGGCGATGATTGCAAGCGTGCTGATTTCAATATTCGCTCTCGTTGCGCCTCTGGCTCCTCTGCTAATCACCATTATTACTCTTCGTATAATTCTTATGCTAATGCAAGTGGACCTCGGTATGCTTCTTCTTCTGGATTTGCCTCTCGCTCTGGTTCCAATGTCGAAGGCTTGGTTACGAATTTTCATATGCTGCTGCGCTTTCTCACTACGCGTGCATTTCTTCTCAATTTTGCTTTCGCCGGGTATTTGTTCTCTACCCTATTTTTCTTGATCGGTACGATTTATGTTTTGAATTCTGATTGCAAATTGCCTCTTCGTACTTTTTTCCATGGTTAA ATGGATGTCCGCGATCACTACAAGGTTCTGGGCTTGAACAGAAGCGCCACGAAAGAGGAAATCAAGGAGGCATTCAGGAAGCTGGCCATGGAATTTCACCCCGACAAGCATTCCCAATCGCCCAAGGCCGTCAGGGACTCCGCTACTCTGAGATTCAAACAGGTTTCGGAAGCCTATGAGATCCTCGGCGATGATTGCAAGCGTGCTGATTTCAATATTCGCTCTCGTTGCGCCTCTGGCTCCTCTGCTAATCACCATTATTACTCTTCGTATAATTCTTATGCTAATGCAAGTGGACCTCGGTATGCTTCTTCTTCTGGATTTGCCTCTCGCTCTGGTTCCAATGTCGAAGGCTTGGTTACGAATTTTCATATGCTGCTGCGCTTTCTCACTACGCGTGCATTTCTTCTCAATTTTGCTTTCGCCGGGTATTTGTTCTCTACCCTATTTTTCTTGATCGGTACGATTTATGTTTTGAATTCTGATTGCAAATTGCCTCTTCGTACTTTTTTCCATGGTTAA MDVRDHYKVLGLNRSATKEEIKEAFRKLAMEFHPDKHSQSPKAVRDSATLRFKQVSEAYEILGDDCKRADFNIRSRCASGSSANHHYYSSYNSYANASGPRYASSSGFASRSGSNVEGLVTNFHMLLRFLTTRAFLLNFAFAGYLFSTLFFLIGTIYVLNSDCKLPLRTFFHG Homology
BLAST of Sgr026732 vs. NCBI nr
Match: KAA0041842.1 (chaperone protein dnaJ 72 [Cucumis melo var. makuwa] >TYK05365.1 chaperone protein dnaJ 72 [Cucumis melo var. makuwa]) HSP 1 Score: 271.6 bits (693), Expect = 4.8e-69 Identity = 144/174 (82.76%), Postives = 150/174 (86.21%), Query Frame = 0
BLAST of Sgr026732 vs. NCBI nr
Match: XP_022154540.1 (chaperone protein dnaJ 72 [Momordica charantia]) HSP 1 Score: 259.2 bits (661), Expect = 2.5e-65 Identity = 136/151 (90.07%), Postives = 139/151 (92.05%), Query Frame = 0
BLAST of Sgr026732 vs. NCBI nr
Match: KAG6595464.1 (Chaperone protein dnaJ 72, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 255.8 bits (652), Expect = 2.7e-64 Identity = 134/152 (88.16%), Postives = 139/152 (91.45%), Query Frame = 0
BLAST of Sgr026732 vs. NCBI nr
Match: KAG7027464.1 (Chaperone protein dnaJ 72 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 255.8 bits (652), Expect = 2.7e-64 Identity = 134/152 (88.16%), Postives = 139/152 (91.45%), Query Frame = 0
BLAST of Sgr026732 vs. NCBI nr
Match: XP_022966465.1 (chaperone protein dnaJ 72 [Cucurbita maxima]) HSP 1 Score: 254.6 bits (649), Expect = 6.1e-64 Identity = 134/152 (88.16%), Postives = 138/152 (90.79%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy Swiss-Prot
Match: Q0WTI8 (Chaperone protein dnaJ 72 OS=Arabidopsis thaliana OX=3702 GN=ATJ72 PE=2 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 1.4e-26 Identity = 72/147 (48.98%), Postives = 97/147 (65.99%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy Swiss-Prot
Match: P78004 (Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) OX=272634 GN=dnaJ PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 2.3e-13 Identity = 35/69 (50.72%), Postives = 52/69 (75.36%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy Swiss-Prot
Match: B4S9D0 (Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=dnaJ PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 3.9e-13 Identity = 39/81 (48.15%), Postives = 58/81 (71.60%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy Swiss-Prot
Match: A1BHL1 (Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=dnaJ PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 6.7e-13 Identity = 40/80 (50.00%), Postives = 56/80 (70.00%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy Swiss-Prot
Match: Q1H3B9 (Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=dnaJ PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 8.7e-13 Identity = 46/113 (40.71%), Postives = 68/113 (60.18%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy TrEMBL
Match: A0A5A7TEJ7 (Chaperone protein dnaJ 72 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold83G00350 PE=4 SV=1) HSP 1 Score: 271.6 bits (693), Expect = 2.3e-69 Identity = 144/174 (82.76%), Postives = 150/174 (86.21%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy TrEMBL
Match: A0A6J1DJW0 (chaperone protein dnaJ 72 OS=Momordica charantia OX=3673 GN=LOC111021790 PE=4 SV=1) HSP 1 Score: 259.2 bits (661), Expect = 1.2e-65 Identity = 136/151 (90.07%), Postives = 139/151 (92.05%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy TrEMBL
Match: A0A0A0L446 (J domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G593910 PE=4 SV=1) HSP 1 Score: 258.8 bits (660), Expect = 1.6e-65 Identity = 136/164 (82.93%), Postives = 146/164 (89.02%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy TrEMBL
Match: A0A6J1HRQ1 (chaperone protein dnaJ 72 OS=Cucurbita maxima OX=3661 GN=LOC111466112 PE=4 SV=1) HSP 1 Score: 254.6 bits (649), Expect = 3.0e-64 Identity = 134/152 (88.16%), Postives = 138/152 (90.79%), Query Frame = 0
BLAST of Sgr026732 vs. ExPASy TrEMBL
Match: A0A6J1EGR8 (chaperone protein dnaJ 72 OS=Cucurbita moschata OX=3662 GN=LOC111432401 PE=4 SV=1) HSP 1 Score: 254.2 bits (648), Expect = 3.9e-64 Identity = 133/152 (87.50%), Postives = 138/152 (90.79%), Query Frame = 0
BLAST of Sgr026732 vs. TAIR 10
Match: AT2G41000.1 (Chaperone DnaJ-domain superfamily protein ) HSP 1 Score: 120.9 bits (302), Expect = 9.8e-28 Identity = 72/147 (48.98%), Postives = 97/147 (65.99%), Query Frame = 0
BLAST of Sgr026732 vs. TAIR 10
Match: AT2G41000.2 (Chaperone DnaJ-domain superfamily protein ) HSP 1 Score: 120.9 bits (302), Expect = 9.8e-28 Identity = 72/147 (48.98%), Postives = 97/147 (65.99%), Query Frame = 0
BLAST of Sgr026732 vs. TAIR 10
Match: AT1G59725.1 (DNAJ heat shock family protein ) HSP 1 Score: 72.4 bits (176), Expect = 4.0e-13 Identity = 42/104 (40.38%), Postives = 69/104 (66.35%), Query Frame = 0
BLAST of Sgr026732 vs. TAIR 10
Match: AT5G03160.1 (homolog of mamallian P58IPK ) HSP 1 Score: 70.1 bits (170), Expect = 2.0e-12 Identity = 33/69 (47.83%), Postives = 54/69 (78.26%), Query Frame = 0
BLAST of Sgr026732 vs. TAIR 10
Match: AT4G28480.1 (DNAJ heat shock family protein ) HSP 1 Score: 68.6 bits (166), Expect = 5.8e-12 Identity = 33/68 (48.53%), Postives = 51/68 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Monk fruit (Qingpiguo) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|