![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Sgr023272 (gene) Monk fruit (Qingpiguo) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGCTGAGGCTGAACCTGCCGGCGAGAGGGGGGGCGTGGTCGTCGTCGGAGTCGGAGTCGGAGTCGGCGTCAGTGAGCATATTTGCAGCGTCGTCGTCGGTGGAGAATTCGTGCGTGTCGTCGTGCGAGGGGGAAGAGCTCGCAGACTCGTCGAGCAGGCGAGAAGGAGTTGAGATAATAACGAGGTCGATGGTGCTGGTGGGATGTCCCGGGTGCTTCATGTACGTGATGCTCACCGACAAGACCTCTCAGTGCCCCAAATGCAAGAACAATGTGTTTCTTGATTTCTTCAAGGACGATGCCTACAAGAATTAG ATGGAGCTGAGGCTGAACCTGCCGGCGAGAGGGGGGGCGTGGTCGTCGTCGGAGTCGGAGTCGGAGTCGGCGTCAGTGAGCATATTTGCAGCGTCGTCGTCGGTGGAGAATTCGTGCGTGTCGTCGTGCGAGGGGGAAGAGCTCGCAGACTCGTCGAGCAGGCGAGAAGGAGTTGAGATAATAACGAGGTCGATGGTGCTGGTGGGATGTCCCGGGTGCTTCATGTACGTGATGCTCACCGACAAGACCTCTCAGTGCCCCAAATGCAAGAACAATGTGTTTCTTGATTTCTTCAAGGACGATGCCTACAAGAATTAG ATGGAGCTGAGGCTGAACCTGCCGGCGAGAGGGGGGGCGTGGTCGTCGTCGGAGTCGGAGTCGGAGTCGGCGTCAGTGAGCATATTTGCAGCGTCGTCGTCGGTGGAGAATTCGTGCGTGTCGTCGTGCGAGGGGGAAGAGCTCGCAGACTCGTCGAGCAGGCGAGAAGGAGTTGAGATAATAACGAGGTCGATGGTGCTGGTGGGATGTCCCGGGTGCTTCATGTACGTGATGCTCACCGACAAGACCTCTCAGTGCCCCAAATGCAAGAACAATGTGTTTCTTGATTTCTTCAAGGACGATGCCTACAAGAATTAG MELRLNLPARGGAWSSSESESESASVSIFAASSSVENSCVSSCEGEELADSSSRREGVEIITRSMVLVGCPGCFMYVMLTDKTSQCPKCKNNVFLDFFKDDAYKN Homology
BLAST of Sgr023272 vs. NCBI nr
Match: KGN48041.1 (hypothetical protein Csa_002820 [Cucumis sativus]) HSP 1 Score: 100.5 bits (249), Expect = 9.0e-18 Identity = 62/103 (60.19%), Postives = 71/103 (68.93%), Query Frame = 0
BLAST of Sgr023272 vs. NCBI nr
Match: KAA0061725.1 (hypothetical protein E6C27_scaffold212G001000 [Cucumis melo var. makuwa] >TYJ96061.1 hypothetical protein E5676_scaffold182G00200 [Cucumis melo var. makuwa]) HSP 1 Score: 99.0 bits (245), Expect = 2.6e-17 Identity = 59/99 (59.60%), Postives = 67/99 (67.68%), Query Frame = 0
BLAST of Sgr023272 vs. NCBI nr
Match: KAG7035922.1 (hypothetical protein SDJN02_02722, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 89.0 bits (219), Expect = 2.7e-14 Identity = 49/88 (55.68%), Postives = 60/88 (68.18%), Query Frame = 0
BLAST of Sgr023272 vs. NCBI nr
Match: KAG6605971.1 (hypothetical protein SDJN03_03288, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 89.0 bits (219), Expect = 2.7e-14 Identity = 49/88 (55.68%), Postives = 60/88 (68.18%), Query Frame = 0
BLAST of Sgr023272 vs. NCBI nr
Match: KAG6570472.1 (NAC domain-containing protein 40, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 87.8 bits (216), Expect = 6.0e-14 Identity = 56/99 (56.57%), Postives = 64/99 (64.65%), Query Frame = 0
BLAST of Sgr023272 vs. ExPASy Swiss-Prot
Match: Q9SRN4 (Protein GL2-INTERACTING REPRESSOR 2 OS=Arabidopsis thaliana OX=3702 GN=GIR2 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.5e-10 Identity = 42/103 (40.78%), Postives = 60/103 (58.25%), Query Frame = 0
BLAST of Sgr023272 vs. ExPASy Swiss-Prot
Match: Q9FNI1 (Protein GL2-INTERACTING REPRESSOR 1 OS=Arabidopsis thaliana OX=3702 GN=GIR1 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-09 Identity = 45/102 (44.12%), Postives = 56/102 (54.90%), Query Frame = 0
BLAST of Sgr023272 vs. ExPASy Swiss-Prot
Match: Q9FMS4 (Protein salt-induced and EIN3/EIL1-dependent 1 OS=Arabidopsis thaliana OX=3702 GN=SIED1 PE=1 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 5.9e-04 Identity = 23/67 (34.33%), Postives = 39/67 (58.21%), Query Frame = 0
BLAST of Sgr023272 vs. ExPASy TrEMBL
Match: A0A0A0KJX5 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G425780 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 4.3e-18 Identity = 62/103 (60.19%), Postives = 71/103 (68.93%), Query Frame = 0
BLAST of Sgr023272 vs. ExPASy TrEMBL
Match: A0A5D3BBS4 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold182G00200 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 1.3e-17 Identity = 59/99 (59.60%), Postives = 67/99 (67.68%), Query Frame = 0
BLAST of Sgr023272 vs. ExPASy TrEMBL
Match: A0A660KQ11 (Uncharacterized protein OS=Carpinus fangiana OX=176857 GN=FH972_009974 PE=4 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 4.3e-10 Identity = 46/106 (43.40%), Postives = 60/106 (56.60%), Query Frame = 0
BLAST of Sgr023272 vs. ExPASy TrEMBL
Match: A0A0L9V640 (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan08g133300 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.8e-09 Identity = 45/103 (43.69%), Postives = 62/103 (60.19%), Query Frame = 0
BLAST of Sgr023272 vs. ExPASy TrEMBL
Match: A0A0S3SBW0 (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.06G159200 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.8e-09 Identity = 45/103 (43.69%), Postives = 62/103 (60.19%), Query Frame = 0
BLAST of Sgr023272 vs. TAIR 10
Match: AT3G11600.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to karrikin; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G06270.1); Has 171 Blast hits to 171 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 171; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 65.1 bits (157), Expect = 3.9e-11 Identity = 42/103 (40.78%), Postives = 60/103 (58.25%), Query Frame = 0
BLAST of Sgr023272 vs. TAIR 10
Match: AT5G06270.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 11 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G11600.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 45/102 (44.12%), Postives = 56/102 (54.90%), Query Frame = 0
BLAST of Sgr023272 vs. TAIR 10
Match: AT5G22270.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G11600.1); Has 136 Blast hits to 136 proteins in 15 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 136; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 45.1 bits (105), Expect = 4.2e-05 Identity = 23/67 (34.33%), Postives = 39/67 (58.21%), Query Frame = 0
BLAST of Sgr023272 vs. TAIR 10
Match: AT3G52561.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G11600.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 41.6 bits (96), Expect = 4.6e-04 Identity = 25/61 (40.98%), Postives = 35/61 (57.38%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Monk fruit (Qingpiguo) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
|