Sgr015040 (gene) Monk fruit (Qingpiguo) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCAGCAATCCTTGATCTATAGCTTCGTTGCGCGCGGGACTGTGATTCTCGCAGAGTATACGGAATTCACCGGGAATTTCACCAGTATAGCCTCCCAGTGCCTCCAGAAGCTTCCCGCCACCAACAACAAGTTCACTTACAATTGCGATGGCCACACCTTCAACTATCTCGTCGATAATGGATTCAGTAACTTTCTCTATCTCTCTTCATTTCTTTCATCGATAGCATCCGTCTTTGTTCCTACGGTTTTCATGGCTGTCGTCTTCTGA ATGGGGCAGCAATCCTTGATCTATAGCTTCGTTGCGCGCGGGACTGTGATTCTCGCAGAGTATACGGAATTCACCGGGAATTTCACCAGTATAGCCTCCCAGTGCCTCCAGAAGCTTCCCGCCACCAACAACAAGTTCACTTACAATTGCGATGGCCACACCTTCAACTATCTCGTCGATAATGGATTCAGTAACTTTCTCTATCTCTCTTCATTTCTTTCATCGATAGCATCCGTCTTTGTTCCTACGGTTTTCATGGCTGTCGTCTTCTGA ATGGGGCAGCAATCCTTGATCTATAGCTTCGTTGCGCGCGGGACTGTGATTCTCGCAGAGTATACGGAATTCACCGGGAATTTCACCAGTATAGCCTCCCAGTGCCTCCAGAAGCTTCCCGCCACCAACAACAAGTTCACTTACAATTGCGATGGCCACACCTTCAACTATCTCGTCGATAATGGATTCAGTAACTTTCTCTATCTCTCTTCATTTCTTTCATCGATAGCATCCGTCTTTGTTCCTACGGTTTTCATGGCTGTCGTCTTCTGA MGQQSLIYSFVARGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVDNGFSNFLYLSSFLSSIASVFVPTVFMAVVF Homology
BLAST of Sgr015040 vs. NCBI nr
Match: KAG5603254.1 (hypothetical protein H5410_034624 [Solanum commersonii]) HSP 1 Score: 134.4 bits (337), Expect = 4.8e-28 Identity = 64/68 (94.12%), Postives = 67/68 (98.53%), Query Frame = 0
BLAST of Sgr015040 vs. NCBI nr
Match: AAQ15287.1 (synptobrevin-related protein, partial [Pyrus pyrifolia]) HSP 1 Score: 133.3 bits (334), Expect = 1.1e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sgr015040 vs. NCBI nr
Match: XP_038886944.1 (vesicle-associated membrane protein 722-like [Benincasa hispida]) HSP 1 Score: 133.3 bits (334), Expect = 1.1e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sgr015040 vs. NCBI nr
Match: ONH92964.1 (hypothetical protein PRUPE_8G204500 [Prunus persica]) HSP 1 Score: 133.3 bits (334), Expect = 1.1e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sgr015040 vs. NCBI nr
Match: XP_008372458.2 (putative vesicle-associated membrane protein 726 [Malus domestica]) HSP 1 Score: 133.3 bits (334), Expect = 1.1e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy Swiss-Prot
Match: Q9MAS5 (Putative vesicle-associated membrane protein 726 OS=Arabidopsis thaliana OX=3702 GN=VAMP726 PE=2 SV=2) HSP 1 Score: 125.2 bits (313), Expect = 3.8e-28 Identity = 57/64 (89.06%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy Swiss-Prot
Match: O48850 (Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana OX=3702 GN=VAMP725 PE=2 SV=2) HSP 1 Score: 121.3 bits (303), Expect = 5.5e-27 Identity = 54/64 (84.38%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy Swiss-Prot
Match: P47192 (Vesicle-associated membrane protein 722 OS=Arabidopsis thaliana OX=3702 GN=VAMP722 PE=2 SV=2) HSP 1 Score: 119.0 bits (297), Expect = 2.7e-26 Identity = 54/64 (84.38%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy Swiss-Prot
Match: Q9ZTW3 (Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana OX=3702 GN=VAMP721 PE=2 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.0e-25 Identity = 53/64 (82.81%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy Swiss-Prot
Match: O23429 (Vesicle-associated membrane protein 724 OS=Arabidopsis thaliana OX=3702 GN=VAMP724 PE=2 SV=2) HSP 1 Score: 107.1 bits (266), Expect = 1.1e-22 Identity = 53/80 (66.25%), Postives = 66/80 (82.50%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy TrEMBL
Match: A0A2P2LS19 (Longin domain-containing protein OS=Rhizophora mucronata OX=61149 PE=3 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 3.0e-28 Identity = 69/81 (85.19%), Postives = 74/81 (91.36%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy TrEMBL
Match: M5VL99 (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_8G204500 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 5.2e-28 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy TrEMBL
Match: M5W4C4 (Longin domain-containing protein OS=Prunus persica OX=3760 GN=PRUPE_8G204500 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 5.2e-28 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy TrEMBL
Match: A0A0B0P3X3 (Vesicle-associated membrane protein OS=Gossypium arboreum OX=29729 GN=F383_03138 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 5.2e-28 Identity = 64/77 (83.12%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of Sgr015040 vs. ExPASy TrEMBL
Match: A0A6J5YB16 (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS51543 PE=3 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 5.2e-28 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Sgr015040 vs. TAIR 10
Match: AT1G04760.1 (vesicle-associated membrane protein 726 ) HSP 1 Score: 125.2 bits (313), Expect = 2.7e-29 Identity = 57/64 (89.06%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of Sgr015040 vs. TAIR 10
Match: AT2G32670.1 (vesicle-associated membrane protein 725 ) HSP 1 Score: 121.3 bits (303), Expect = 3.9e-28 Identity = 54/64 (84.38%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of Sgr015040 vs. TAIR 10
Match: AT2G33120.2 (synaptobrevin-related protein 1 ) HSP 1 Score: 121.3 bits (303), Expect = 3.9e-28 Identity = 57/70 (81.43%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of Sgr015040 vs. TAIR 10
Match: AT2G33120.1 (synaptobrevin-related protein 1 ) HSP 1 Score: 119.0 bits (297), Expect = 1.9e-27 Identity = 54/64 (84.38%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Sgr015040 vs. TAIR 10
Match: AT1G04750.1 (vesicle-associated membrane protein 721 ) HSP 1 Score: 117.1 bits (292), Expect = 7.4e-27 Identity = 53/64 (82.81%), Postives = 61/64 (95.31%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Monk fruit (Qingpiguo) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|