![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Sed0007880 (gene) Chayote v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSexonpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTGGATAACTTAGCCAACCCTTATGATCTCGTTCGCCACCTCGCCGAGTGCAATGCCGTGGTTGTTTTCAGCCTTACGGGCTGCTGCATGTCGACAGTCGTCAAGCGCCTTCTCTTCGGTCTCGGTGTCGGTCCCACCGTCGTCGAGCTCGATCTCCTCTCCCACTCCTCCGCTGACCACATCCAAGCCGTCCTCCACCACCTCCTCCCTAATTCTCACCCCGGTCACCACCCGGTCCCCGCCGTCTTCGTTGGTGGAAAGTTCCTCGGTGGCCTCGAGACTCTCATGTCCTCGCATATCAATGGCTCCCTCGTCCCCCTCCTCAAACAAGCAGGAGCTCTTTGGCTTTAA ATGGAATTGGATAACTTAGCCAACCCTTATGATCTCGTTCGCCACCTCGCCGAGTGCAATGCCGTGGTTGTTTTCAGCCTTACGGGCTGCTGCATGTCGACAGTCGTCAAGCGCCTTCTCTTCGGTCTCGGTGTCGGTCCCACCGTCGTCGAGCTCGATCTCCTCTCCCACTCCTCCGCTGACCACATCCAAGCCGTCCTCCACCACCTCCTCCCTAATTCTCACCCCGGTCACCACCCGGTCCCCGCCGTCTTCGTTGGTGGAAAGTTCCTCGGTGGCCTCGAGACTCTCATGTCCTCGCATATCAATGGCTCCCTCGTCCCCCTCCTCAAACAAGCAGGAGCTCTTTGGCTTTAA ATGGAATTGGATAACTTAGCCAACCCTTATGATCTCGTTCGCCACCTCGCCGAGTGCAATGCCGTGGTTGTTTTCAGCCTTACGGGCTGCTGCATGTCGACAGTCGTCAAGCGCCTTCTCTTCGGTCTCGGTGTCGGTCCCACCGTCGTCGAGCTCGATCTCCTCTCCCACTCCTCCGCTGACCACATCCAAGCCGTCCTCCACCACCTCCTCCCTAATTCTCACCCCGGTCACCACCCGGTCCCCGCCGTCTTCGTTGGTGGAAAGTTCCTCGGTGGCCTCGAGACTCTCATGTCCTCGCATATCAATGGCTCCCTCGTCCCCCTCCTCAAACAAGCAGGAGCTCTTTGGCTTTAA MELDNLANPYDLVRHLAECNAVVVFSLTGCCMSTVVKRLLFGLGVGPTVVELDLLSHSSADHIQAVLHHLLPNSHPGHHPVPAVFVGGKFLGGLETLMSSHINGSLVPLLKQAGALWL Homology
BLAST of Sed0007880 vs. NCBI nr
Match: XP_022925986.1 (glutaredoxin-C9-like [Cucurbita moschata] >XP_023543935.1 glutaredoxin-C9-like [Cucurbita pepo subsp. pepo] >KAG6581443.1 Glutaredoxin-C1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7034736.1 Glutaredoxin-C1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 193.7 bits (491), Expect = 8.7e-46 Identity = 98/118 (83.05%), Postives = 107/118 (90.68%), Query Frame = 0
BLAST of Sed0007880 vs. NCBI nr
Match: KAE8647751.1 (hypothetical protein Csa_003767 [Cucumis sativus]) HSP 1 Score: 187.2 bits (474), Expect = 8.2e-44 Identity = 93/110 (84.55%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of Sed0007880 vs. NCBI nr
Match: PON72684.1 (Glutaredoxin-like [Parasponia andersonii]) HSP 1 Score: 160.6 bits (405), Expect = 8.2e-36 Identity = 80/111 (72.07%), Postives = 92/111 (82.88%), Query Frame = 0
BLAST of Sed0007880 vs. NCBI nr
Match: PON82368.1 (Glutaredoxin-like [Trema orientale]) HSP 1 Score: 160.6 bits (405), Expect = 8.2e-36 Identity = 80/111 (72.07%), Postives = 92/111 (82.88%), Query Frame = 0
BLAST of Sed0007880 vs. NCBI nr
Match: XP_021593354.1 (glutaredoxin-C9-like [Manihot esculenta] >KAG8637451.1 hypothetical protein MANES_15G124000v8 [Manihot esculenta]) HSP 1 Score: 156.0 bits (393), Expect = 2.0e-34 Identity = 77/116 (66.38%), Postives = 92/116 (79.31%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy Swiss-Prot
Match: Q7XIZ1 (Glutaredoxin-C9 OS=Oryza sativa subsp. japonica OX=39947 GN=GRXC9 PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.1e-30 Identity = 71/109 (65.14%), Postives = 81/109 (74.31%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy Swiss-Prot
Match: Q8LF89 (Glutaredoxin-C8 OS=Arabidopsis thaliana OX=3702 GN=GRXC8 PE=1 SV=2) HSP 1 Score: 102.1 bits (253), Expect = 4.5e-21 Identity = 56/108 (51.85%), Postives = 73/108 (67.59%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy Swiss-Prot
Match: Q96305 (Glutaredoxin-C7 OS=Arabidopsis thaliana OX=3702 GN=GRXC7 PE=1 SV=2) HSP 1 Score: 99.4 bits (246), Expect = 2.9e-20 Identity = 57/109 (52.29%), Postives = 71/109 (65.14%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy Swiss-Prot
Match: Q9SGP6 (Glutaredoxin-C9 OS=Arabidopsis thaliana OX=3702 GN=GRXC9 PE=1 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.8e-20 Identity = 50/106 (47.17%), Postives = 69/106 (65.09%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy Swiss-Prot
Match: Q6K609 (Glutaredoxin-C3 OS=Oryza sativa subsp. japonica OX=39947 GN=GRXC3 PE=2 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 6.6e-20 Identity = 55/109 (50.46%), Postives = 70/109 (64.22%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy TrEMBL
Match: A0A6J1EDM5 (glutaredoxin-C9-like OS=Cucurbita moschata OX=3662 GN=LOC111433239 PE=3 SV=1) HSP 1 Score: 193.7 bits (491), Expect = 4.2e-46 Identity = 98/118 (83.05%), Postives = 107/118 (90.68%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy TrEMBL
Match: A0A0A0KI63 (Glutaredoxin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G524040 PE=3 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 1.4e-44 Identity = 97/118 (82.20%), Postives = 104/118 (88.14%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy TrEMBL
Match: A0A2P5DHA6 (Glutaredoxin-like OS=Parasponia andersonii OX=3476 GN=PanWU01x14_064500 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 4.0e-36 Identity = 80/111 (72.07%), Postives = 92/111 (82.88%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy TrEMBL
Match: A0A2P5EA05 (Glutaredoxin-like OS=Trema orientale OX=63057 GN=TorRG33x02_218630 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 4.0e-36 Identity = 80/111 (72.07%), Postives = 92/111 (82.88%), Query Frame = 0
BLAST of Sed0007880 vs. ExPASy TrEMBL
Match: A0A2N9GT16 (Glutaredoxin domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS30382 PE=3 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 1.2e-35 Identity = 81/118 (68.64%), Postives = 94/118 (79.66%), Query Frame = 0
BLAST of Sed0007880 vs. TAIR 10
Match: AT5G14070.1 (Thioredoxin superfamily protein ) HSP 1 Score: 102.1 bits (253), Expect = 3.2e-22 Identity = 56/108 (51.85%), Postives = 73/108 (67.59%), Query Frame = 0
BLAST of Sed0007880 vs. TAIR 10
Match: AT3G02000.1 (Thioredoxin superfamily protein ) HSP 1 Score: 99.4 bits (246), Expect = 2.1e-21 Identity = 57/109 (52.29%), Postives = 71/109 (65.14%), Query Frame = 0
BLAST of Sed0007880 vs. TAIR 10
Match: AT1G28480.1 (Thioredoxin superfamily protein ) HSP 1 Score: 99.0 bits (245), Expect = 2.7e-21 Identity = 50/106 (47.17%), Postives = 69/106 (65.09%), Query Frame = 0
BLAST of Sed0007880 vs. TAIR 10
Match: AT3G21460.1 (Glutaredoxin family protein ) HSP 1 Score: 90.9 bits (224), Expect = 7.4e-19 Identity = 54/109 (49.54%), Postives = 67/109 (61.47%), Query Frame = 0
BLAST of Sed0007880 vs. TAIR 10
Match: AT1G03850.2 (Glutaredoxin family protein ) HSP 1 Score: 90.5 bits (223), Expect = 9.7e-19 Identity = 47/99 (47.47%), Postives = 62/99 (62.63%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Chayote (edule) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|