Sed0007435 (gene) Chayote v1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CTAGTATAAATACATAACTCGTGTTCCAAAATGAAACACACGCAATTGAAAACTTTGTCAACCATCTCTTGAAAGTTATGAGCAATTCGCCAAACAAGTACGGAGGCTGGAGTGAGATCGAGAACCCGAATGACAACCCGAAAGTGCGAGAAATTGCAGAGTGGGCAGTGAAAGAGTACAACAAACAAAATGGGAAATCGTTAGTGTTTCATAGTATCTTAAAGGGCTGGCAACAAGTGGTGGCTGGAATGAACTATCGTCTTGTGCTATATGCATATGATGAATATGATAGCCCAAATAATCTTCACAAATATGAGGCTCGCGTGTATGATAAGCCATGGGTGCCTTATAGGGAGCTTACATCTTTTAACCCTCTTCTTGGGTGATAGAGGGAAAAAGAAAATACTAATTTTGTAATTGAAATACCTATGATGTACTCAATTATGATATCTATCTATCCATAGTGGAAATATAATAAAATAACTAAGCATATTATGGTTACTTATATTTTTTAGTTTGCT CTAGTATAAATACATAACTCGTGTTCCAAAATGAAACACACGCAATTGAAAACTTTGTCAACCATCTCTTGAAAGTTATGAGCAATTCGCCAAACAAGTACGGAGGCTGGAGTGAGATCGAGAACCCGAATGACAACCCGAAAGTGCGAGAAATTGCAGAGTGGGCAGTGAAAGAGTACAACAAACAAAATGGGAAATCGTTAGTGTTTCATAGTATCTTAAAGGGCTGGCAACAAGTGGTGGCTGGAATGAACTATCGTCTTGTGCTATATGCATATGATGAATATGATAGCCCAAATAATCTTCACAAATATGAGGCTCGCGTGTATGATAAGCCATGGGTGCCTTATAGGGAGCTTACATCTTTTAACCCTCTTCTTGGGTGATAGAGGGAAAAAGAAAATACTAATTTTGTAATTGAAATACCTATGATGTACTCAATTATGATATCTATCTATCCATAGTGGAAATATAATAAAATAACTAAGCATATTATGGTTACTTATATTTTTTAGTTTGCT ATGAGCAATTCGCCAAACAAGTACGGAGGCTGGAGTGAGATCGAGAACCCGAATGACAACCCGAAAGTGCGAGAAATTGCAGAGTGGGCAGTGAAAGAGTACAACAAACAAAATGGGAAATCGTTAGTGTTTCATAGTATCTTAAAGGGCTGGCAACAAGTGGTGGCTGGAATGAACTATCGTCTTGTGCTATATGCATATGATGAATATGATAGCCCAAATAATCTTCACAAATATGAGGCTCGCGTGTATGATAAGCCATGGGTGCCTTATAGGGAGCTTACATCTTTTAACCCTCTTCTTGGGTGA MSNSPNKYGGWSEIENPNDNPKVREIAEWAVKEYNKQNGKSLVFHSILKGWQQVVAGMNYRLVLYAYDEYDSPNNLHKYEARVYDKPWVPYRELTSFNPLLG Homology
BLAST of Sed0007435 vs. NCBI nr
Match: XP_019425190.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Lupinus angustifolius] >OIV91844.1 hypothetical protein TanjilG_17836 [Lupinus angustifolius]) HSP 1 Score: 97.1 bits (240), Expect = 9.6e-17 Identity = 50/95 (52.63%), Postives = 67/95 (70.53%), Query Frame = 0
BLAST of Sed0007435 vs. NCBI nr
Match: MQM15186.1 (hypothetical protein [Colocasia esculenta]) HSP 1 Score: 94.7 bits (234), Expect = 4.8e-16 Identity = 54/94 (57.45%), Postives = 64/94 (68.09%), Query Frame = 0
BLAST of Sed0007435 vs. NCBI nr
Match: XP_017219057.1 (PREDICTED: cysteine proteinase inhibitor 1-like [Daucus carota subsp. sativus] >KZN09569.1 hypothetical protein DCAR_002225 [Daucus carota subsp. sativus]) HSP 1 Score: 93.6 bits (231), Expect = 1.1e-15 Identity = 48/93 (51.61%), Postives = 65/93 (69.89%), Query Frame = 0
BLAST of Sed0007435 vs. NCBI nr
Match: KAF1895344.1 (hypothetical protein Lal_00043990 [Lupinus albus]) HSP 1 Score: 93.2 bits (230), Expect = 1.4e-15 Identity = 49/89 (55.06%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of Sed0007435 vs. NCBI nr
Match: KAE9599108.1 (putative Cystatin domain-containing protein [Lupinus albus]) HSP 1 Score: 93.2 bits (230), Expect = 1.4e-15 Identity = 49/89 (55.06%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 83.6 bits (205), Expect = 1.4e-15 Identity = 44/89 (49.44%), Postives = 61/89 (68.54%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 82.4 bits (202), Expect = 3.2e-15 Identity = 45/93 (48.39%), Postives = 58/93 (62.37%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 5.5e-15 Identity = 43/89 (48.31%), Postives = 61/89 (68.54%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.2e-11 Identity = 38/91 (41.76%), Postives = 53/91 (58.24%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy Swiss-Prot
Match: Q41906 (Cysteine proteinase inhibitor 3 OS=Arabidopsis thaliana OX=3702 GN=CYS3 PE=2 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 4.5e-09 Identity = 33/89 (37.08%), Postives = 53/89 (59.55%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy TrEMBL
Match: A0A4P1QPV7 (Cystatin domain-containing protein OS=Lupinus angustifolius OX=3871 GN=TanjilG_17836 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 4.7e-17 Identity = 50/95 (52.63%), Postives = 67/95 (70.53%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy TrEMBL
Match: A0A166H0B8 (Cystatin domain-containing protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_002225 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 5.2e-16 Identity = 48/93 (51.61%), Postives = 65/93 (69.89%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy TrEMBL
Match: A0A6A4PE35 (Putative Cystatin domain-containing protein OS=Lupinus albus OX=3870 GN=Lalb_Chr15g0088031 PE=4 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 6.7e-16 Identity = 49/89 (55.06%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy TrEMBL
Match: A0A6A5PD78 (Cystatin domain-containing protein OS=Lupinus albus OX=3870 GN=Lal_00043990 PE=4 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 6.7e-16 Identity = 49/89 (55.06%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of Sed0007435 vs. ExPASy TrEMBL
Match: A0A426WY08 (Cystatin domain-containing protein OS=Ensete ventricosum OX=4639 GN=B296_00051057 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 8.8e-16 Identity = 50/100 (50.00%), Postives = 66/100 (66.00%), Query Frame = 0
BLAST of Sed0007435 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 82.4 bits (202), Expect = 2.3e-16 Identity = 45/93 (48.39%), Postives = 58/93 (62.37%), Query Frame = 0
BLAST of Sed0007435 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 62.0 bits (149), Expect = 3.2e-10 Identity = 33/89 (37.08%), Postives = 53/89 (59.55%), Query Frame = 0
BLAST of Sed0007435 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 59.3 bits (142), Expect = 2.1e-09 Identity = 34/96 (35.42%), Postives = 55/96 (57.29%), Query Frame = 0
BLAST of Sed0007435 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 56.2 bits (134), Expect = 1.8e-08 Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 0
BLAST of Sed0007435 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 56.2 bits (134), Expect = 1.8e-08 Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Chayote (edule) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|