Sed0007003 (gene) Chayote v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGATCAGAGGACCTAATACTTCAATACAGTTGTTGATGAAGGATGAGAATGTAAGGGAGAAATTAACTCGCTTTTTGAGTACATCAACAGGGACAAGCTCAGATGAAATAGTTGATCGAGTAATTGGATTGGTTAAGAAATTTGATAGAATCGATGCCTGTAAGGTATTTAGTCCAAGGCCACCCCATCATCTGACCTTTTAACTTTTATATCACTTGTCAAGATTTTTCTAGATTCGATCTTAATTATCATGACCATGGAATGCAATATAATGTATTTTTGTTGAAATAATGATCTTATTCAACGTTGGATGTTGTGTTGAGCCGAGCAGGTTACTGAAACGGCTGATTTCCAGAAAGACTTGAGCTTGGACAGCTTGGATAGGGTGGAGCTCGTAATGGCTTTCGAACAAGAATTCTCCATTGAAATCCCAGATGAACAGGCCGATAAGCTTACCTGCTGTGCCGATGTAGCACAATACATAACTTCACAAGTTGATGAAAAGAAAGAGGAGAAGCATTGA ATGAAGATCAGAGGACCTAATACTTCAATACAGTTGTTGATGAAGGATGAGAATGTAAGGGAGAAATTAACTCGCTTTTTGAGTACATCAACAGGGACAAGCTCAGATGAAATAGTTGATCGAGTAATTGGATTGGTTAAGAAATTTGATAGAATCGATGCCTGTAAGGTTACTGAAACGGCTGATTTCCAGAAAGACTTGAGCTTGGACAGCTTGGATAGGGTGGAGCTCGTAATGGCTTTCGAACAAGAATTCTCCATTGAAATCCCAGATGAACAGGCCGATAAGCTTACCTGCTGTGCCGATGTAGCACAATACATAACTTCACAAGTTGATGAAAAGAAAGAGGAGAAGCATTGA ATGAAGATCAGAGGACCTAATACTTCAATACAGTTGTTGATGAAGGATGAGAATGTAAGGGAGAAATTAACTCGCTTTTTGAGTACATCAACAGGGACAAGCTCAGATGAAATAGTTGATCGAGTAATTGGATTGGTTAAGAAATTTGATAGAATCGATGCCTGTAAGGTTACTGAAACGGCTGATTTCCAGAAAGACTTGAGCTTGGACAGCTTGGATAGGGTGGAGCTCGTAATGGCTTTCGAACAAGAATTCTCCATTGAAATCCCAGATGAACAGGCCGATAAGCTTACCTGCTGTGCCGATGTAGCACAATACATAACTTCACAAGTTGATGAAAAGAAAGAGGAGAAGCATTGA MKIRGPNTSIQLLMKDENVREKLTRFLSTSTGTSSDEIVDRVIGLVKKFDRIDACKVTETADFQKDLSLDSLDRVELVMAFEQEFSIEIPDEQADKLTCCADVAQYITSQVDEKKEEKH Homology
BLAST of Sed0007003 vs. NCBI nr
Match: XP_038895695.1 (acyl carrier protein 3, mitochondrial [Benincasa hispida] >XP_038895696.1 acyl carrier protein 3, mitochondrial [Benincasa hispida]) HSP 1 Score: 211.1 bits (536), Expect = 5.3e-51 Identity = 109/118 (92.37%), Postives = 113/118 (95.76%), Query Frame = 0
BLAST of Sed0007003 vs. NCBI nr
Match: XP_023001631.1 (acyl carrier protein 3, mitochondrial [Cucurbita maxima] >XP_023001632.1 acyl carrier protein 3, mitochondrial [Cucurbita maxima]) HSP 1 Score: 203.0 bits (515), Expect = 1.5e-48 Identity = 104/119 (87.39%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Sed0007003 vs. NCBI nr
Match: KAG6583746.1 (Acyl carrier protein 3, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 201.8 bits (512), Expect = 3.2e-48 Identity = 103/119 (86.55%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Sed0007003 vs. NCBI nr
Match: XP_022927340.1 (acyl carrier protein 3, mitochondrial isoform X2 [Cucurbita moschata] >KAG7019387.1 Acyl carrier protein 3, mitochondrial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 201.8 bits (512), Expect = 3.2e-48 Identity = 103/119 (86.55%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Sed0007003 vs. NCBI nr
Match: XP_022927338.1 (acyl carrier protein 3, mitochondrial isoform X1 [Cucurbita moschata]) HSP 1 Score: 201.8 bits (512), Expect = 3.2e-48 Identity = 103/119 (86.55%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy Swiss-Prot
Match: Q9FGJ4 (Acyl carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP2 PE=1 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.2e-24 Identity = 62/108 (57.41%), Postives = 78/108 (72.22%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy Swiss-Prot
Match: P53665 (Acyl carrier protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP1 PE=1 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.7e-15 Identity = 40/82 (48.78%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy Swiss-Prot
Match: O80800 (Acyl carrier protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MTACP2 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.4e-14 Identity = 44/94 (46.81%), Postives = 56/94 (59.57%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy Swiss-Prot
Match: Q54E22 (Acyl carrier protein, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=ndufab1 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 4.1e-14 Identity = 38/74 (51.35%), Postives = 53/74 (71.62%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy Swiss-Prot
Match: P11943 (Acyl carrier protein, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nuo-12 PE=1 SV=2) HSP 1 Score: 78.6 bits (192), Expect = 5.4e-14 Identity = 42/89 (47.19%), Postives = 55/89 (61.80%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy TrEMBL
Match: A0A6J1KJ66 (Acyl carrier protein OS=Cucurbita maxima OX=3661 GN=LOC111495700 PE=3 SV=1) HSP 1 Score: 203.0 bits (515), Expect = 7.0e-49 Identity = 104/119 (87.39%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy TrEMBL
Match: A0A6J1ENM4 (Acyl carrier protein OS=Cucurbita moschata OX=3662 GN=LOC111434196 PE=3 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 1.6e-48 Identity = 103/119 (86.55%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy TrEMBL
Match: A0A6J1EKQ6 (Acyl carrier protein OS=Cucurbita moschata OX=3662 GN=LOC111434196 PE=3 SV=1) HSP 1 Score: 201.8 bits (512), Expect = 1.6e-48 Identity = 103/119 (86.55%), Postives = 111/119 (93.28%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy TrEMBL
Match: A0A1S3CK44 (Acyl carrier protein OS=Cucumis melo OX=3656 GN=LOC103501710 PE=3 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 1.3e-47 Identity = 103/118 (87.29%), Postives = 110/118 (93.22%), Query Frame = 0
BLAST of Sed0007003 vs. ExPASy TrEMBL
Match: A0A5D3E4S4 (Acyl carrier protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G00340 PE=3 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 1.3e-47 Identity = 103/118 (87.29%), Postives = 110/118 (93.22%), Query Frame = 0
BLAST of Sed0007003 vs. TAIR 10
Match: AT5G47630.1 (mitochondrial acyl carrier protein 3 ) HSP 1 Score: 114.0 bits (284), Expect = 8.3e-26 Identity = 62/108 (57.41%), Postives = 78/108 (72.22%), Query Frame = 0
BLAST of Sed0007003 vs. TAIR 10
Match: AT5G47630.2 (mitochondrial acyl carrier protein 3 ) HSP 1 Score: 114.0 bits (284), Expect = 8.3e-26 Identity = 62/108 (57.41%), Postives = 78/108 (72.22%), Query Frame = 0
BLAST of Sed0007003 vs. TAIR 10
Match: AT2G44620.1 (mitochondrial acyl carrier protein 1 ) HSP 1 Score: 83.6 bits (205), Expect = 1.2e-16 Identity = 40/82 (48.78%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of Sed0007003 vs. TAIR 10
Match: AT1G65290.1 (mitochondrial acyl carrier protein 2 ) HSP 1 Score: 79.7 bits (195), Expect = 1.7e-15 Identity = 44/94 (46.81%), Postives = 56/94 (59.57%), Query Frame = 0
BLAST of Sed0007003 vs. TAIR 10
Match: AT3G05020.1 (acyl carrier protein 1 ) HSP 1 Score: 51.2 bits (121), Expect = 6.6e-07 Identity = 34/99 (34.34%), Postives = 54/99 (54.55%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Chayote (edule) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|