Sed0005117 (gene) Chayote v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTAGAATTAAACGAGCATATATAGCTCAGAGACGTAGAATAAAAATTTGTTTATTTGGATCAAGCTTTCGAGGGGCTCATTCACGACTTACTCGAAATATTACTCAACAGAAAATAAGAGCTTTGGCTTCAGCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCAACAGTTGTGGATCACTCGAATAAATGCAGTAATTCGAAATAATAAGGTAGACTCCAGTTATAGTAGATTCATACACAATCTGTACAAGAGGTAGTTGTTTCTTAATCGTAAAATACTTGCCCAAATCGCTATATTAAATAGGATTTTTCTTTATATGATTTCCAATGAGATCATAAAATAA ATGACTAGAATTAAACGAGCATATATAGCTCAGAGACGTAGAATAAAAATTTGTTTATTTGGATCAAGCTTTCGAGGGGCTCATTCACGACTTACTCGAAATATTACTCAACAGAAAATAAGAGCTTTGGCTTCAGCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCAACAGTTGTGGATCACTCGAATAAATGCAGTAATTCGAAATAATAAGTTGTTTCTTAATCGTAAAATACTTGCCCAAATCGCTATATTAAATAGGATTTTTCTTTATATGATTTCCAATGAGATCATAAAATAA ATGACTAGAATTAAACGAGCATATATAGCTCAGAGACGTAGAATAAAAATTTGTTTATTTGGATCAAGCTTTCGAGGGGCTCATTCACGACTTACTCGAAATATTACTCAACAGAAAATAAGAGCTTTGGCTTCAGCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCAACAGTTGTGGATCACTCGAATAAATGCAGTAATTCGAAATAATAAGTTGTTTCTTAATCGTAAAATACTTGCCCAAATCGCTATATTAAATAGGATTTTTCTTTATATGATTTCCAATGAGATCATAAAATAA MTRIKRAYIAQRRRIKICLFGSSFRGAHSRLTRNITQQKIRALASAYRDRGRQKRNFQQLWITRINAVIRNNKLFLNRKILAQIAILNRIFLYMISNEIIK Homology
BLAST of Sed0005117 vs. NCBI nr
Match: YP_009752519.1 (ribosomal protein L20 [Trichosanthes tubiflora] >QIT04915.1 ribosomal protein L20 [Trichosanthes tubiflora]) HSP 1 Score: 153.7 bits (387), Expect = 8.6e-34 Identity = 90/117 (76.92%), Postives = 93/117 (79.49%), Query Frame = 0
BLAST of Sed0005117 vs. NCBI nr
Match: YP_009751676.1 (ribosomal protein L20 [Hodgsonia heteroclita] >QIT04409.1 ribosomal protein L20 [Hodgsonia heteroclita]) HSP 1 Score: 153.3 bits (386), Expect = 1.1e-33 Identity = 90/117 (76.92%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. NCBI nr
Match: YP_009752266.1 (ribosomal protein L20 [Trichosanthes baviensis] >YP_009753197.1 ribosomal protein L20 [Trichosanthes truncata] >YP_009753812.1 ribosomal protein L20 [Trichosanthes pilosa] >YP_009753897.1 ribosomal protein L20 [Trichosanthes lobata] >QJD26494.1 ribosomal protein L20 [Trichosanthes kirilowii var. japonica] >QJD26668.1 ribosomal protein L20 [Trichosanthes rosthornii] >QIT04240.1 ribosomal protein L20 [Trichosanthes baviensis] >QIT05676.1 ribosomal protein L20 [Trichosanthes pilosa] >QIT05845.1 ribosomal protein L20 [Trichosanthes lobata]) HSP 1 Score: 152.5 bits (384), Expect = 1.9e-33 Identity = 90/117 (76.92%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. NCBI nr
Match: YP_009560858.1 (ribosomal protein L20 [Trichosanthes kirilowii] >YP_009751929.1 ribosomal protein L20 [Cyclanthera pedata] >YP_009752435.1 ribosomal protein L20 [Trichosanthes tricuspidata] >YP_009753643.1 ribosomal protein L20 [Trichosanthes wallichiana] >YP_009753728.1 ribosomal protein L20 [Trichosanthes nervifolia] >YP_009945440.1 ribosomal protein L20 [Sechium edule] >QAB33211.1 ribosomal protein L20 [Trichosanthes kirilowii] >QIT04156.1 ribosomal protein L20 [Sechium edule] >QIT04662.1 ribosomal protein L20 [Trichosanthes wallichiana] >QIT04747.1 ribosomal protein L20 [Cyclanthera pedata] >QIT04831.1 ribosomal protein L20 [Trichosanthes tricuspidata]) HSP 1 Score: 152.5 bits (384), Expect = 1.9e-33 Identity = 90/117 (76.92%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. NCBI nr
Match: YP_009326012.1 (ribosomal protein L20 [Citrullus lanatus] >YP_009348054.1 ribosomal protein L20 [Citrullus mucosospermus] >YP_009431580.1 ribosomal protein L20 [Citrullus amarus] >APW82484.1 ribosomal protein L20 [Citrullus lanatus subsp. vulgaris] >QZL38704.1 ribosomal protein L20 [Citrullus ecirrhosus] >APD52503.1 ribosomal protein L20 [Citrullus lanatus] >APW82569.1 ribosomal protein L20 [Citrullus lanatus subsp. vulgaris] >APW82654.1 ribosomal protein L20 [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 151.8 bits (382), Expect = 3.3e-33 Identity = 89/117 (76.07%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy Swiss-Prot
Match: Q4VZJ4 (50S ribosomal protein L20, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl20 PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.2e-35 Identity = 88/117 (75.21%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy Swiss-Prot
Match: Q09G23 (50S ribosomal protein L20, chloroplastic OS=Platanus occidentalis OX=4403 GN=rpl20 PE=3 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 9.9e-33 Identity = 82/117 (70.09%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy Swiss-Prot
Match: Q09WZ4 (50S ribosomal protein L20, chloroplastic OS=Morus indica OX=248361 GN=rpl20 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.7e-32 Identity = 82/117 (70.09%), Postives = 90/117 (76.92%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy Swiss-Prot
Match: A6MM59 (50S ribosomal protein L20, chloroplastic OS=Buxus microphylla OX=153571 GN=rpl20 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.4e-31 Identity = 79/117 (67.52%), Postives = 90/117 (76.92%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy Swiss-Prot
Match: B1NWH3 (50S ribosomal protein L20, chloroplastic OS=Manihot esculenta OX=3983 GN=rpl20 PE=3 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.9e-31 Identity = 81/117 (69.23%), Postives = 90/117 (76.92%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy TrEMBL
Match: A0A6H0EST1 (50S ribosomal protein L20, chloroplastic OS=Trichosanthes tubiflora OX=1144424 GN=rpl20 PE=3 SV=1) HSP 1 Score: 153.7 bits (387), Expect = 4.2e-34 Identity = 90/117 (76.92%), Postives = 93/117 (79.49%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy TrEMBL
Match: A0A6H0ES93 (50S ribosomal protein L20, chloroplastic OS=Hodgsonia heteroclita OX=386184 GN=rpl20 PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 5.4e-34 Identity = 90/117 (76.92%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy TrEMBL
Match: A0A6M3S4F6 (50S ribosomal protein L20, chloroplastic OS=Trichosanthes kirilowii var. japonica OX=61011 GN=rpl20 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 9.3e-34 Identity = 90/117 (76.92%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy TrEMBL
Match: A0A6H0ERB9 (50S ribosomal protein L20, chloroplastic OS=Trichosanthes tricuspidata OX=654837 GN=rpl20 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 9.3e-34 Identity = 90/117 (76.92%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. ExPASy TrEMBL
Match: A0A6H0EQD1 (50S ribosomal protein L20, chloroplastic OS=Trichosanthes baviensis OX=1054457 GN=rpl20 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 9.3e-34 Identity = 90/117 (76.92%), Postives = 92/117 (78.63%), Query Frame = 0
BLAST of Sed0005117 vs. TAIR 10
Match: ATCG00660.1 (ribosomal protein L20 ) HSP 1 Score: 128.3 bits (321), Expect = 3.6e-30 Identity = 74/117 (63.25%), Postives = 87/117 (74.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Chayote (edule) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|