Sed0001683 (gene) Chayote v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACCGTATAGCGAAGTTGGCGTCACAGAAGGCAGTGGTGATATTCAGCAAGAGCTCGTGCTGCATGAGCCATGCAATCAAGAGACTCTTTTACGACCAAGGCGTTAGCCCCGCCGTGTACGAGCTCGACGAGGACTCGAGAGGGAAGGAGATTGAATGGGCTCTTTTACGCCTCGGCTGCAACCCCACCGTGCCCGCTGTCTTCATCGGTGGTCGATTCATCGGCTCTGCCAATGCCATCATCACGCTCCACCTCAATGGCTGCCTCAACAAGTTGCTCAAGGAAGCCGGGGCGCTTTGGCTCTAA ATGGACCGTATAGCGAAGTTGGCGTCACAGAAGGCAGTGGTGATATTCAGCAAGAGCTCGTGCTGCATGAGCCATGCAATCAAGAGACTCTTTTACGACCAAGGCGTTAGCCCCGCCGTGTACGAGCTCGACGAGGACTCGAGAGGGAAGGAGATTGAATGGGCTCTTTTACGCCTCGGCTGCAACCCCACCGTGCCCGCTGTCTTCATCGGTGGTCGATTCATCGGCTCTGCCAATGCCATCATCACGCTCCACCTCAATGGCTGCCTCAACAAGTTGCTCAAGGAAGCCGGGGCGCTTTGGCTCTAA ATGGACCGTATAGCGAAGTTGGCGTCACAGAAGGCAGTGGTGATATTCAGCAAGAGCTCGTGCTGCATGAGCCATGCAATCAAGAGACTCTTTTACGACCAAGGCGTTAGCCCCGCCGTGTACGAGCTCGACGAGGACTCGAGAGGGAAGGAGATTGAATGGGCTCTTTTACGCCTCGGCTGCAACCCCACCGTGCCCGCTGTCTTCATCGGTGGTCGATTCATCGGCTCTGCCAATGCCATCATCACGCTCCACCTCAATGGCTGCCTCAACAAGTTGCTCAAGGAAGCCGGGGCGCTTTGGCTCTAA MDRIAKLASQKAVVIFSKSSCCMSHAIKRLFYDQGVSPAVYELDEDSRGKEIEWALLRLGCNPTVPAVFIGGRFIGSANAIITLHLNGCLNKLLKEAGALWL Homology
BLAST of Sed0001683 vs. NCBI nr
Match: XP_022944909.1 (monothiol glutaredoxin-S10-like [Cucurbita moschata] >XP_022973704.1 monothiol glutaredoxin-S10-like [Cucurbita maxima] >XP_023540480.1 monothiol glutaredoxin-S10-like [Cucurbita pepo subsp. pepo] >KAG6597502.1 Monothiol glutaredoxin-S10, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 206.5 bits (524), Expect = 1.1e-49 Identity = 99/102 (97.06%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of Sed0001683 vs. NCBI nr
Match: NP_001275534.1 (monothiol glutaredoxin-S10-like [Cucumis sativus] >XP_008438822.1 PREDICTED: monothiol glutaredoxin-S10-like [Cucumis melo] >KAA0049452.1 monothiol glutaredoxin-S10-like [Cucumis melo var. makuwa] >AGX01497.1 glutaredoxin [Cucumis sativus] >KGN57081.1 hypothetical protein Csa_010184 [Cucumis sativus] >TYK16131.1 monothiol glutaredoxin-S10-like [Cucumis melo var. makuwa]) HSP 1 Score: 204.5 bits (519), Expect = 4.3e-49 Identity = 98/102 (96.08%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of Sed0001683 vs. NCBI nr
Match: XP_038905584.1 (monothiol glutaredoxin-S10-like [Benincasa hispida]) HSP 1 Score: 202.6 bits (514), Expect = 1.6e-48 Identity = 97/102 (95.10%), Postives = 100/102 (98.04%), Query Frame = 0
BLAST of Sed0001683 vs. NCBI nr
Match: XP_023527596.1 (monothiol glutaredoxin-S10-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 199.1 bits (505), Expect = 1.8e-47 Identity = 95/102 (93.14%), Postives = 100/102 (98.04%), Query Frame = 0
BLAST of Sed0001683 vs. NCBI nr
Match: XP_022979996.1 (monothiol glutaredoxin-S10-like [Cucurbita maxima]) HSP 1 Score: 196.8 bits (499), Expect = 8.9e-47 Identity = 94/102 (92.16%), Postives = 100/102 (98.04%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy Swiss-Prot
Match: Q9LIF1 (Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana OX=3702 GN=GRXS10 PE=3 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 9.0e-42 Identity = 77/102 (75.49%), Postives = 93/102 (91.18%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy Swiss-Prot
Match: O23421 (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana OX=3702 GN=GRXS3 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 2.0e-33 Identity = 66/102 (64.71%), Postives = 82/102 (80.39%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy Swiss-Prot
Match: O23419 (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana OX=3702 GN=GRXS4 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.4e-33 Identity = 65/102 (63.73%), Postives = 82/102 (80.39%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy Swiss-Prot
Match: Q8L8Z8 (Monothiol glutaredoxin-S2 OS=Arabidopsis thaliana OX=3702 GN=GRXS2 PE=3 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 7.6e-33 Identity = 66/102 (64.71%), Postives = 79/102 (77.45%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy Swiss-Prot
Match: O23417 (Monothiol glutaredoxin-S8 OS=Arabidopsis thaliana OX=3702 GN=GRXS8 PE=3 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.0e-32 Identity = 64/102 (62.75%), Postives = 82/102 (80.39%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy TrEMBL
Match: A0A6J1IFF3 (monothiol glutaredoxin-S10-like OS=Cucurbita maxima OX=3661 GN=LOC111472287 PE=3 SV=1) HSP 1 Score: 206.5 bits (524), Expect = 5.5e-50 Identity = 99/102 (97.06%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy TrEMBL
Match: A0A6J1FZG5 (monothiol glutaredoxin-S10-like OS=Cucurbita moschata OX=3662 GN=LOC111449297 PE=3 SV=1) HSP 1 Score: 206.5 bits (524), Expect = 5.5e-50 Identity = 99/102 (97.06%), Postives = 102/102 (100.00%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy TrEMBL
Match: U3RBS4 (Glutaredoxin OS=Cucumis sativus OX=3659 GN=GRX5 PE=2 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 2.1e-49 Identity = 98/102 (96.08%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy TrEMBL
Match: A0A5D3CW51 (Monothiol glutaredoxin-S10-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold209G00560 PE=3 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 2.1e-49 Identity = 98/102 (96.08%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of Sed0001683 vs. ExPASy TrEMBL
Match: A0A1S3AXZ6 (monothiol glutaredoxin-S10-like OS=Cucumis melo OX=3656 GN=LOC103483808 PE=3 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 2.1e-49 Identity = 98/102 (96.08%), Postives = 101/102 (99.02%), Query Frame = 0
BLAST of Sed0001683 vs. TAIR 10
Match: AT3G21460.1 (Glutaredoxin family protein ) HSP 1 Score: 170.6 bits (431), Expect = 6.4e-43 Identity = 77/102 (75.49%), Postives = 93/102 (91.18%), Query Frame = 0
BLAST of Sed0001683 vs. TAIR 10
Match: AT4G15700.1 (Thioredoxin superfamily protein ) HSP 1 Score: 142.9 bits (359), Expect = 1.4e-34 Identity = 66/102 (64.71%), Postives = 82/102 (80.39%), Query Frame = 0
BLAST of Sed0001683 vs. TAIR 10
Match: AT4G15680.1 (Thioredoxin superfamily protein ) HSP 1 Score: 142.1 bits (357), Expect = 2.4e-34 Identity = 65/102 (63.73%), Postives = 82/102 (80.39%), Query Frame = 0
BLAST of Sed0001683 vs. TAIR 10
Match: AT5G18600.1 (Thioredoxin superfamily protein ) HSP 1 Score: 141.0 bits (354), Expect = 5.4e-34 Identity = 66/102 (64.71%), Postives = 79/102 (77.45%), Query Frame = 0
BLAST of Sed0001683 vs. TAIR 10
Match: AT4G15660.1 (Thioredoxin superfamily protein ) HSP 1 Score: 140.6 bits (353), Expect = 7.1e-34 Identity = 64/102 (62.75%), Postives = 82/102 (80.39%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Chayote (edule) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|