Pay0017928 (gene) Melon (Payzawat) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSexonpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAACAAAGTTCTTCCGTTCACAGTTGTTTGTCTTTTCGTGGTGGCCGTTCTTGGCAGAGTTCGTGTTGCAGAGGCGGTGAGTTGCAACCCTGTGGAGCTGAGCTCATGTTCCGGGGCAATCACGTCGGGGATGAACCCATCCAGCATTTGCTGCAACAAATTAAAACAGCAGGAAGCATGTCTTTGCGGGTACATAAAGAACCCAGCTTTGGGGCCTTATGTGAATTCTCCTGGCACCAAACGTGTTGCTTCCAAATGTGGGGTTCCCATTCCAAGTTGTTAG ATGAACAAAGTTCTTCCGTTCACAGTTGTTTGTCTTTTCGTGGTGGCCGTTCTTGGCAGAGTTCGTGTTGCAGAGGCGGTGAGTTGCAACCCTGTGGAGCTGAGCTCATGTTCCGGGGCAATCACGTCGGGGATGAACCCATCCAGCATTTGCTGCAACAAATTAAAACAGCAGGAAGCATGTCTTTGCGGGTACATAAAGAACCCAGCTTTGGGGCCTTATGTGAATTCTCCTGGCACCAAACGTGTTGCTTCCAAATGTGGGGTTCCCATTCCAAGTTGTTAG ATGAACAAAGTTCTTCCGTTCACAGTTGTTTGTCTTTTCGTGGTGGCCGTTCTTGGCAGAGTTCGTGTTGCAGAGGCGGTGAGTTGCAACCCTGTGGAGCTGAGCTCATGTTCCGGGGCAATCACGTCGGGGATGAACCCATCCAGCATTTGCTGCAACAAATTAAAACAGCAGGAAGCATGTCTTTGCGGGTACATAAAGAACCCAGCTTTGGGGCCTTATGTGAATTCTCCTGGCACCAAACGTGTTGCTTCCAAATGTGGGGTTCCCATTCCAAGTTGTTAG MNKVLPFTVVCLFVVAVLGRVRVAEAVSCNPVELSSCSGAITSGMNPSSICCNKLKQQEACLCGYIKNPALGPYVNSPGTKRVASKCGVPIPSC Homology
BLAST of Pay0017928 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 7.8e-24 Identity = 57/97 (58.76%), Postives = 65/97 (67.01%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 9.8e-19 Identity = 38/68 (55.88%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 3.5e-16 Identity = 36/64 (56.25%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy Swiss-Prot
Match: P20145 (Probable non-specific lipid-transfer protein OS=Hordeum vulgare OX=4513 GN=LTP2 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.6e-14 Identity = 34/94 (36.17%), Postives = 50/94 (53.19%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy Swiss-Prot
Match: A2XBN5 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica OX=39946 GN=LTP-2 PE=3 SV=2) HSP 1 Score: 78.2 bits (191), Expect = 5.6e-14 Identity = 34/94 (36.17%), Postives = 52/94 (55.32%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy TrEMBL
Match: A0A6J1GTR0 (non-specific lipid-transfer protein 2-like OS=Cucurbita moschata OX=3662 GN=LOC111457455 PE=4 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 1.3e-26 Identity = 61/95 (64.21%), Postives = 75/95 (78.95%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy TrEMBL
Match: I1N5L5 (AAI domain-containing protein OS=Glycine max OX=3847 GN=GLYMA_19G002300 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 5.2e-23 Identity = 53/94 (56.38%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy TrEMBL
Match: A0A0B2QIV0 (Putative non-specific lipid-transfer protein AKCS9 OS=Glycine soja OX=3848 GN=glysoja_037194 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 5.2e-23 Identity = 53/94 (56.38%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy TrEMBL
Match: I1K1M7 (AAI domain-containing protein OS=Glycine max OX=3847 GN=GLYMA_05G002200 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.2e-22 Identity = 54/94 (57.45%), Postives = 68/94 (72.34%), Query Frame = 0
BLAST of Pay0017928 vs. ExPASy TrEMBL
Match: J7FQE3 (Non-specific lipid-transfer protein type 2 (Fragment) OS=Olea europaea OX=4146 PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.2e-22 Identity = 51/81 (62.96%), Postives = 65/81 (80.25%), Query Frame = 0
BLAST of Pay0017928 vs. NCBI nr
Match: XP_022955426.1 (non-specific lipid-transfer protein 2-like [Cucurbita moschata]) HSP 1 Score: 128.6 bits (322), Expect = 2.8e-26 Identity = 61/95 (64.21%), Postives = 75/95 (78.95%), Query Frame = 0
BLAST of Pay0017928 vs. NCBI nr
Match: KAG6581748.1 (hypothetical protein SDJN03_21750, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 127.9 bits (320), Expect = 4.7e-26 Identity = 61/95 (64.21%), Postives = 74/95 (77.89%), Query Frame = 0
BLAST of Pay0017928 vs. NCBI nr
Match: XP_038897809.1 (non-specific lipid-transfer protein 2-like [Benincasa hispida]) HSP 1 Score: 127.1 bits (318), Expect = 8.0e-26 Identity = 59/97 (60.82%), Postives = 77/97 (79.38%), Query Frame = 0
BLAST of Pay0017928 vs. NCBI nr
Match: KHN19692.1 (Putative non-specific lipid-transfer protein AKCS9 [Glycine soja] >KRG93187.1 hypothetical protein GLYMA_19G002300v4 [Glycine max]) HSP 1 Score: 116.7 bits (291), Expect = 1.1e-22 Identity = 53/94 (56.38%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of Pay0017928 vs. NCBI nr
Match: KAG5027746.1 (hypothetical protein JHK87_011260 [Glycine soja] >KAG5039223.1 hypothetical protein JHK85_011699 [Glycine max] >KAG5056377.1 hypothetical protein JHK86_011373 [Glycine max] >KAG5153415.1 hypothetical protein JHK82_011384 [Glycine max] >KRH56524.1 hypothetical protein GLYMA_05G002200v4 [Glycine max]) HSP 1 Score: 115.5 bits (288), Expect = 2.4e-22 Identity = 54/94 (57.45%), Postives = 68/94 (72.34%), Query Frame = 0
BLAST of Pay0017928 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 97.8 bits (242), Expect = 4.8e-21 Identity = 44/94 (46.81%), Postives = 66/94 (70.21%), Query Frame = 0
BLAST of Pay0017928 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 90.5 bits (223), Expect = 7.7e-19 Identity = 42/90 (46.67%), Postives = 64/90 (71.11%), Query Frame = 0
BLAST of Pay0017928 vs. TAIR 10
Match: AT1G73780.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-16 Identity = 37/88 (42.05%), Postives = 51/88 (57.95%), Query Frame = 0
BLAST of Pay0017928 vs. TAIR 10
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 78.2 bits (191), Expect = 4.0e-15 Identity = 32/68 (47.06%), Postives = 46/68 (67.65%), Query Frame = 0
BLAST of Pay0017928 vs. TAIR 10
Match: AT1G66850.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-14 Identity = 31/68 (45.59%), Postives = 43/68 (63.24%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Payzawat) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|