Pay0015427 (gene) Melon (Payzawat) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSexonpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAGCAAAGCTTCAGGATTCGATGGTACAGAAAGAAGCCCTCCAAGATCAAGTCAAGGTTAGGAACGTGAAGTTGAATCCAATTCTGTTTTACTAATTAACTGCTGTAATGCAATAAATTCACGTCTTACAAATCATGGTAATGTAGATCATAGGTGGTGATTTGGATGGAGTGAGGAAGGAACAACAAGCCATTAGAGCCAAGATAAAGCAACTCGATGATGCCTTGAAGGCAATAGACAATGAAATTAAAACTTTGCAGGATGAGCTAACTTCTATTACAGAGAAGAGAGGCAGAGCTCACGAAAGCATTCAGCAACTTAGGAAGAATCGTGATGAGGGGGTGTGTTGGATTACTTGA ATGAGAGCAAAGCTTCAGGATTCGATGGTACAGAAAGAAGCCCTCCAAGATCAAGTCAAGATCATAGGTGGTGATTTGGATGGAGTGAGGAAGGAACAACAAGCCATTAGAGCCAAGATAAAGCAACTCGATGATGCCTTGAAGGCAATAGACAATGAAATTAAAACTTTGCAGGATGAGCTAACTTCTATTACAGAGAAGAGAGGCAGAGCTCACGAAAGCATTCAGCAACTTAGGAAGAATCGTGATGAGGGGGTGTGTTGGATTACTTGA ATGAGAGCAAAGCTTCAGGATTCGATGGTACAGAAAGAAGCCCTCCAAGATCAAGTCAAGATCATAGGTGGTGATTTGGATGGAGTGAGGAAGGAACAACAAGCCATTAGAGCCAAGATAAAGCAACTCGATGATGCCTTGAAGGCAATAGACAATGAAATTAAAACTTTGCAGGATGAGCTAACTTCTATTACAGAGAAGAGAGGCAGAGCTCACGAAAGCATTCAGCAACTTAGGAAGAATCGTGATGAGGGGGTGTGTTGGATTACTTGA MRAKLQDSMVQKEALQDQVKIIGGDLDGVRKEQQAIRAKIKQLDDALKAIDNEIKTLQDELTSITEKRGRAHESIQQLRKNRDEGVCWIT Homology
BLAST of Pay0015427 vs. ExPASy Swiss-Prot
Match: Q762B4 (Proton pump-interactor BIP103 OS=Oryza sativa subsp. japonica OX=39947 GN=BIP103 PE=1 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 7.2e-19 Identity = 46/82 (56.10%), Postives = 69/82 (84.15%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy Swiss-Prot
Match: O23144 (Proton pump-interactor 1 OS=Arabidopsis thaliana OX=3702 GN=PPI1 PE=1 SV=2) HSP 1 Score: 86.3 bits (212), Expect = 2.0e-16 Identity = 43/84 (51.19%), Postives = 65/84 (77.38%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy Swiss-Prot
Match: Q6ZBF6 (Proton pump-interactor BIP131 OS=Oryza sativa subsp. japonica OX=39947 GN=BIP131 PE=1 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 6.3e-15 Identity = 39/82 (47.56%), Postives = 62/82 (75.61%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy Swiss-Prot
Match: B3H4K7 (Proton pump-interactor 2 OS=Arabidopsis thaliana OX=3702 GN=PPI2 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 7.0e-06 Identity = 30/80 (37.50%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy Swiss-Prot
Match: P0DKC1 (Proton pump-interactor 3A OS=Arabidopsis thaliana OX=3702 GN=PPI3A PE=3 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 6.6e-04 Identity = 30/75 (40.00%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy TrEMBL
Match: A0A5D3DRR5 (Proton pump-interactor 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold14G00960 PE=4 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 6.5e-39 Identity = 87/90 (96.67%), Postives = 88/90 (97.78%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy TrEMBL
Match: A0A1S3CNG2 (proton pump-interactor 1-like OS=Cucumis melo OX=3656 GN=LOC103502909 PE=4 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 6.5e-39 Identity = 87/90 (96.67%), Postives = 88/90 (97.78%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy TrEMBL
Match: A0A1S3BUN5 (proton pump-interactor 1 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103493484 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 8.8e-36 Identity = 83/85 (97.65%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy TrEMBL
Match: A0A5D3D9V7 (Proton pump-interactor 1 isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold134G004000 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 8.8e-36 Identity = 83/85 (97.65%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of Pay0015427 vs. ExPASy TrEMBL
Match: A0A5A7VD69 (Proton pump-interactor 1 isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold255G00250 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 8.8e-36 Identity = 83/85 (97.65%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of Pay0015427 vs. NCBI nr
Match: KAA0067079.1 (proton pump-interactor 1 [Cucumis melo var. makuwa] >TYK26316.1 proton pump-interactor 1 [Cucumis melo var. makuwa]) HSP 1 Score: 169.5 bits (428), Expect = 1.3e-38 Identity = 87/90 (96.67%), Postives = 88/90 (97.78%), Query Frame = 0
BLAST of Pay0015427 vs. NCBI nr
Match: XP_008465256.1 (PREDICTED: proton pump-interactor 1-like [Cucumis melo]) HSP 1 Score: 169.5 bits (428), Expect = 1.3e-38 Identity = 87/90 (96.67%), Postives = 88/90 (97.78%), Query Frame = 0
BLAST of Pay0015427 vs. NCBI nr
Match: XP_008452453.1 (PREDICTED: proton pump-interactor 1 isoform X1 [Cucumis melo] >XP_008452454.1 PREDICTED: proton pump-interactor 1 isoform X2 [Cucumis melo]) HSP 1 Score: 159.1 bits (401), Expect = 1.8e-35 Identity = 83/85 (97.65%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of Pay0015427 vs. NCBI nr
Match: XP_011654071.2 (proton pump-interactor 1 [Cucumis sativus]) HSP 1 Score: 159.1 bits (401), Expect = 1.8e-35 Identity = 83/85 (97.65%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of Pay0015427 vs. NCBI nr
Match: KAA0064326.1 (proton pump-interactor 1 isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 159.1 bits (401), Expect = 1.8e-35 Identity = 83/85 (97.65%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of Pay0015427 vs. TAIR 10
Match: AT4G27500.1 (proton pump interactor 1 ) HSP 1 Score: 86.3 bits (212), Expect = 1.4e-17 Identity = 43/84 (51.19%), Postives = 65/84 (77.38%), Query Frame = 0
BLAST of Pay0015427 vs. TAIR 10
Match: AT3G15340.1 (proton pump interactor 2 ) HSP 1 Score: 51.2 bits (121), Expect = 5.0e-07 Identity = 30/80 (37.50%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of Pay0015427 vs. TAIR 10
Match: AT3G15340.2 (proton pump interactor 2 ) HSP 1 Score: 51.2 bits (121), Expect = 5.0e-07 Identity = 30/80 (37.50%), Postives = 48/80 (60.00%), Query Frame = 0
BLAST of Pay0015427 vs. TAIR 10
Match: AT5G36780.1 (AT5G36780 and AT5G36690 represent identical copies. The duplication within clone F27C7 is believed an artifact with only one true copy existing. ) HSP 1 Score: 44.7 bits (104), Expect = 4.7e-05 Identity = 30/75 (40.00%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of Pay0015427 vs. TAIR 10
Match: AT5G36690.1 (AT5G36690 and AT5G36780 represent identical copies. The duplication within clone F27C7 is believed an artifact with only one true copy existing. ) HSP 1 Score: 44.7 bits (104), Expect = 4.7e-05 Identity = 30/75 (40.00%), Postives = 41/75 (54.67%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Payzawat) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|