Pay0010236 (gene) Melon (Payzawat) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAATCTCTTTCCGTCACTTTGGTTCTTCTTTCATTTATTCTGAGCTCATTCTTCCTCCAGTATGGCACTGCCGATTCCTCTACAACCTATGCTCCAAGTAAGATAAATGATTTACCATTAATATATAAATACTATTGGCAATGAATATACAACCTTGCATTTCATTCTCTTGTTCAACGATTCAACTGGTTTATGTTTTGATCCTTTTTCCGTTTTTTTTCGTTTTCTTTCTTGAAAGGTGTTTGTGATTCAAAATGTGGGGTAAGATGCTTGAATGCAGGGGTGAAGGACAGGTGTTTGAAGTATTGTGGACTCTGCTGCCAACAGTGCAAGTGCGTGCCCTCTGGAACCTATGGAAACAAATCAGAATGCCCTTGTTATAGAGACAAGTTGAACTCCAAGGGAAAATCTAAATGCCCTTGA ATGAAATCTCTTTCCGTCACTTTGGTTCTTCTTTCATTTATTCTGAGCTCATTCTTCCTCCAGTATGGCACTGCCGATTCCTCTACAACCTATGCTCCAAGTGTTTGTGATTCAAAATGTGGGGTAAGATGCTTGAATGCAGGGGTGAAGGACAGGTGTTTGAAGTATTGTGGACTCTGCTGCCAACAGTGCAAGTGCGTGCCCTCTGGAACCTATGGAAACAAATCAGAATGCCCTTGTTATAGAGACAAGTTGAACTCCAAGGGAAAATCTAAATGCCCTTGA ATGAAATCTCTTTCCGTCACTTTGGTTCTTCTTTCATTTATTCTGAGCTCATTCTTCCTCCAGTATGGCACTGCCGATTCCTCTACAACCTATGCTCCAAGTGTTTGTGATTCAAAATGTGGGGTAAGATGCTTGAATGCAGGGGTGAAGGACAGGTGTTTGAAGTATTGTGGACTCTGCTGCCAACAGTGCAAGTGCGTGCCCTCTGGAACCTATGGAAACAAATCAGAATGCCCTTGTTATAGAGACAAGTTGAACTCCAAGGGAAAATCTAAATGCCCTTGA MKSLSVTLVLLSFILSSFFLQYGTADSSTTYAPSVCDSKCGVRCLNAGVKDRCLKYCGLCCQQCKCVPSGTYGNKSECPCYRDKLNSKGKSKCP Homology
BLAST of Pay0010236 vs. ExPASy Swiss-Prot
Match: Q948Z4 (Snakin-1 OS=Solanum tuberosum OX=4113 GN=SN1 PE=1 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.4e-27 Identity = 56/94 (59.57%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy Swiss-Prot
Match: P86888 (Peamaclein OS=Prunus persica OX=3760 PE=1 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 3.5e-24 Identity = 46/61 (75.41%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy Swiss-Prot
Match: Q8LFM2 (Gibberellin-regulated protein 10 OS=Arabidopsis thaliana OX=3702 GN=GASA10 PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.6e-23 Identity = 53/95 (55.79%), Postives = 65/95 (68.42%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy Swiss-Prot
Match: O80641 (Gibberellin-regulated protein 8 OS=Arabidopsis thaliana OX=3702 GN=At2g39540 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.5e-22 Identity = 51/94 (54.26%), Postives = 62/94 (65.96%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy Swiss-Prot
Match: O82328 (Gibberellin-regulated protein 7 OS=Arabidopsis thaliana OX=3702 GN=GASA7 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.6e-21 Identity = 57/108 (52.78%), Postives = 65/108 (60.19%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy TrEMBL
Match: A0A1S3B1M5 (peamaclein-like OS=Cucumis melo OX=3656 GN=LOC103484820 PE=3 SV=1) HSP 1 Score: 197.6 bits (501), Expect = 2.3e-47 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy TrEMBL
Match: A0A0A0KLG3 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G493840 PE=3 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 9.2e-44 Identity = 90/95 (94.74%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy TrEMBL
Match: A0A6J1HEX9 (peamaclein-like OS=Cucurbita moschata OX=3662 GN=LOC111463556 PE=3 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 1.4e-39 Identity = 80/94 (85.11%), Postives = 85/94 (90.43%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy TrEMBL
Match: A0A6J1KSF0 (peamaclein-like OS=Cucurbita maxima OX=3661 GN=LOC111496836 PE=3 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 6.8e-39 Identity = 79/94 (84.04%), Postives = 84/94 (89.36%), Query Frame = 0
BLAST of Pay0010236 vs. ExPASy TrEMBL
Match: A0A5D3CMS1 (Peamaclein-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G004370 PE=3 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 1.3e-34 Identity = 79/94 (84.04%), Postives = 79/94 (84.04%), Query Frame = 0
BLAST of Pay0010236 vs. NCBI nr
Match: XP_008440339.1 (PREDICTED: peamaclein-like [Cucumis melo]) HSP 1 Score: 197.6 bits (501), Expect = 4.8e-47 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of Pay0010236 vs. NCBI nr
Match: XP_031742788.1 (peamaclein-like isoform X2 [Cucumis sativus]) HSP 1 Score: 191.8 bits (486), Expect = 2.6e-45 Identity = 91/94 (96.81%), Postives = 92/94 (97.87%), Query Frame = 0
BLAST of Pay0010236 vs. NCBI nr
Match: XP_031742787.1 (peamaclein-like isoform X1 [Cucumis sativus]) HSP 1 Score: 185.7 bits (470), Expect = 1.9e-43 Identity = 90/95 (94.74%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Pay0010236 vs. NCBI nr
Match: XP_038880848.1 (peamaclein-like [Benincasa hispida]) HSP 1 Score: 181.4 bits (459), Expect = 3.6e-42 Identity = 86/94 (91.49%), Postives = 87/94 (92.55%), Query Frame = 0
BLAST of Pay0010236 vs. NCBI nr
Match: KAG7026958.1 (Snakin-1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 173.7 bits (439), Expect = 7.5e-40 Identity = 81/94 (86.17%), Postives = 86/94 (91.49%), Query Frame = 0
BLAST of Pay0010236 vs. TAIR 10
Match: AT5G59845.1 (Gibberellin-regulated family protein ) HSP 1 Score: 107.5 bits (267), Expect = 6.1e-24 Identity = 53/95 (55.79%), Postives = 65/95 (68.42%), Query Frame = 0
BLAST of Pay0010236 vs. TAIR 10
Match: AT2G39540.1 (Gibberellin-regulated family protein ) HSP 1 Score: 105.9 bits (263), Expect = 1.8e-23 Identity = 51/94 (54.26%), Postives = 62/94 (65.96%), Query Frame = 0
BLAST of Pay0010236 vs. TAIR 10
Match: AT2G14900.1 (Gibberellin-regulated family protein ) HSP 1 Score: 103.2 bits (256), Expect = 1.2e-22 Identity = 57/108 (52.78%), Postives = 65/108 (60.19%), Query Frame = 0
BLAST of Pay0010236 vs. TAIR 10
Match: AT1G10588.1 (Gibberellin-regulated family protein ) HSP 1 Score: 95.9 bits (237), Expect = 1.8e-20 Identity = 48/90 (53.33%), Postives = 57/90 (63.33%), Query Frame = 0
BLAST of Pay0010236 vs. TAIR 10
Match: AT1G10588.2 (Gibberellin-regulated family protein ) HSP 1 Score: 95.5 bits (236), Expect = 2.4e-20 Identity = 48/90 (53.33%), Postives = 57/90 (63.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Payzawat) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|