
Pay0010061 (gene) Melon (Payzawat) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGACGAACGAACAACAAATTGCATCGATATCCTCCTCGCTATTCTCCTCCCTCCTCTTGGTGTCTTTCTCAAATTTGGATGCCAAGTCTGATCATCATCTCTTCTTTATTCTTCTCTTAATTTTATTTTTCATTTTCAAATTTCATTATCTCACTAACTCTCTCTTTCAATTACTTCATCATTTCAGGTTGAGTTTTGGATCTGCTTGGTCCTAACTTTCTTTGGTTACATCCCTGGCATTATTTATGCTGTTTATGCCATCACCAAGTGA ATGGCAGACGAACGAACAACAAATTGCATCGATATCCTCCTCGCTATTCTCCTCCCTCCTCTTGGTGTCTTTCTCAAATTTGGATGCCAAGTTGAGTTTTGGATCTGCTTGGTCCTAACTTTCTTTGGTTACATCCCTGGCATTATTTATGCTGTTTATGCCATCACCAAGTGA ATGGCAGACGAACGAACAACAAATTGCATCGATATCCTCCTCGCTATTCTCCTCCCTCCTCTTGGTGTCTTTCTCAAATTTGGATGCCAAGTTGAGTTTTGGATCTGCTTGGTCCTAACTTTCTTTGGTTACATCCCTGGCATTATTTATGCTGTTTATGCCATCACCAAGTGA MADERTTNCIDILLAILLPPLGVFLKFGCQVEFWICLVLTFFGYIPGIIYAVYAITK Homology
BLAST of Pay0010061 vs. ExPASy Swiss-Prot
Match: A2Y075 (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica OX=39946 GN=LTI6B PE=3 SV=2) HSP 1 Score: 94.7 bits (234), Expect = 3.5e-19 Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy Swiss-Prot
Match: Q0DKW8 (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica OX=39947 GN=LTI6B PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.5e-19 Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy Swiss-Prot
Match: Q8H5T6 (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica OX=39947 GN=LTI6A PE=2 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 7.8e-19 Identity = 44/57 (77.19%), Postives = 50/57 (87.72%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy Swiss-Prot
Match: Q9ZNS6 (Hydrophobic protein RCI2B OS=Arabidopsis thaliana OX=3702 GN=RCI2B PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 9.5e-17 Identity = 38/52 (73.08%), Postives = 47/52 (90.38%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy Swiss-Prot
Match: Q9ZNQ7 (Hydrophobic protein RCI2A OS=Arabidopsis thaliana OX=3702 GN=RCI2A PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 1.6e-16 Identity = 39/52 (75.00%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy TrEMBL
Match: A0A1S3BNR9 (hydrophobic protein LTI6B-like OS=Cucumis melo OX=3656 GN=LOC103492093 PE=3 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 1.1e-23 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy TrEMBL
Match: A0A0A0M1D6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G560745 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 7.1e-23 Identity = 56/57 (98.25%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy TrEMBL
Match: A0A4Y7IL50 (Uncharacterized protein OS=Papaver somniferum OX=3469 GN=C5167_017259 PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.0e-21 Identity = 51/57 (89.47%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy TrEMBL
Match: A0A1S2XTZ3 (hydrophobic protein LTI6B-like OS=Cicer arietinum OX=3827 GN=LOC101498830 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.3e-21 Identity = 53/57 (92.98%), Postives = 54/57 (94.74%), Query Frame = 0
BLAST of Pay0010061 vs. ExPASy TrEMBL
Match: A0A2K3L766 (Hydrophobic protein LTI6A-like OS=Trifolium pratense OX=57577 GN=L195_g030288 PE=3 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 8.6e-21 Identity = 52/57 (91.23%), Postives = 53/57 (92.98%), Query Frame = 0
BLAST of Pay0010061 vs. NCBI nr
Match: XP_008450512.1 (PREDICTED: hydrophobic protein LTI6B-like [Cucumis melo]) HSP 1 Score: 118.2 bits (295), Expect = 2.3e-23 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of Pay0010061 vs. NCBI nr
Match: XP_038879764.1 (hydrophobic protein LTI6B-like [Benincasa hispida]) HSP 1 Score: 115.9 bits (289), Expect = 1.1e-22 Identity = 56/57 (98.25%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Pay0010061 vs. NCBI nr
Match: KGN65991.1 (hypothetical protein Csa_007015 [Cucumis sativus]) HSP 1 Score: 115.5 bits (288), Expect = 1.5e-22 Identity = 56/57 (98.25%), Postives = 56/57 (98.25%), Query Frame = 0
BLAST of Pay0010061 vs. NCBI nr
Match: RZC48826.1 (hypothetical protein C5167_017259 [Papaver somniferum] >RZC88164.1 hypothetical protein C5167_015966 [Papaver somniferum]) HSP 1 Score: 111.7 bits (278), Expect = 2.1e-21 Identity = 51/57 (89.47%), Postives = 55/57 (96.49%), Query Frame = 0
BLAST of Pay0010061 vs. NCBI nr
Match: XP_004494506.1 (hydrophobic protein LTI6B-like [Cicer arietinum]) HSP 1 Score: 111.3 bits (277), Expect = 2.8e-21 Identity = 53/57 (92.98%), Postives = 54/57 (94.74%), Query Frame = 0
BLAST of Pay0010061 vs. TAIR 10
Match: AT3G05890.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 86.7 bits (213), Expect = 6.8e-18 Identity = 38/52 (73.08%), Postives = 47/52 (90.38%), Query Frame = 0
BLAST of Pay0010061 vs. TAIR 10
Match: AT3G05880.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 85.9 bits (211), Expect = 1.2e-17 Identity = 39/52 (75.00%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Pay0010061 vs. TAIR 10
Match: AT2G38905.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 75.5 bits (184), Expect = 1.6e-14 Identity = 33/46 (71.74%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of Pay0010061 vs. TAIR 10
Match: AT1G57550.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 68.2 bits (165), Expect = 2.5e-12 Identity = 27/48 (56.25%), Postives = 41/48 (85.42%), Query Frame = 0
BLAST of Pay0010061 vs. TAIR 10
Match: AT4G30650.1 (Low temperature and salt responsive protein family ) HSP 1 Score: 65.5 bits (158), Expect = 1.6e-11 Identity = 38/56 (67.86%), Postives = 41/56 (73.21%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Payzawat) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|