![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Pay0004383 (gene) Melon (Payzawat) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTTGAGATGGCTGCTTCATTCAACAAGTTATCTTCTTGGTAACCCAAATGAGGCCCATGCCTATGGTGAAGAGAGAAGTTCAACAGGGAAAAAGGGTTATGAAGAAATATGCAATTCTGGGTTTCAAATGCCTCTTCATTACCCTCGCTACAAGAAGTCGGATTATCAAAATATGGAGGGGTGGAAGCTGGATCTCCTTCTCAAGGAATATGGCTTGAGTTTTCAAGGCAGTTTAGAGGAGAAGAGGGCCTTTGCAATGGGTGCATTTATATGGCCTGATCAGTATTGA ATGGATTTGAGATGGCTGCTTCATTCAACAAGTTATCTTCTTGGTAACCCAAATGAGGCCCATGCCTATGGTGAAGAGAGAAGTTCAACAGGGAAAAAGGGTTATGAAGAAATATGCAATTCTGGGTTTCAAATGCCTCTTCATTACCCTCGCTACAAGAAGTCGGATTATCAAAATATGGAGGGGTGGAAGCTGGATCTCCTTCTCAAGGAATATGGCTTGAGTTTTCAAGGCAGTTTAGAGGAGAAGAGGGCCTTTGCAATGGGTGCATTTATATGGCCTGATCAGTATTGA ATGGATTTGAGATGGCTGCTTCATTCAACAAGTTATCTTCTTGGTAACCCAAATGAGGCCCATGCCTATGGTGAAGAGAGAAGTTCAACAGGGAAAAAGGGTTATGAAGAAATATGCAATTCTGGGTTTCAAATGCCTCTTCATTACCCTCGCTACAAGAAGTCGGATTATCAAAATATGGAGGGGTGGAAGCTGGATCTCCTTCTCAAGGAATATGGCTTGAGTTTTCAAGGCAGTTTAGAGGAGAAGAGGGCCTTTGCAATGGGTGCATTTATATGGCCTGATCAGTATTGA MDLRWLLHSTSYLLGNPNEAHAYGEERSSTGKKGYEEICNSGFQMPLHYPRYKKSDYQNMEGWKLDLLLKEYGLSFQGSLEEKRAFAMGAFIWPDQY Homology
BLAST of Pay0004383 vs. ExPASy TrEMBL
Match: A0A5D3CP92 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G005850 PE=4 SV=1) HSP 1 Score: 210.7 bits (535), Expect = 2.8e-51 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Pay0004383 vs. ExPASy TrEMBL
Match: A0A0A0KMW8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G511080 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 2.9e-45 Identity = 88/96 (91.67%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of Pay0004383 vs. ExPASy TrEMBL
Match: A0A6J1BUU9 (uncharacterized protein LOC111005569 OS=Momordica charantia OX=3673 GN=LOC111005569 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 4.6e-30 Identity = 70/107 (65.42%), Postives = 79/107 (73.83%), Query Frame = 0
BLAST of Pay0004383 vs. ExPASy TrEMBL
Match: A0A7J0EYW1 (Uncharacterized protein OS=Actinidia rufa OX=165716 GN=Acr_08g0000310 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 5.8e-25 Identity = 60/106 (56.60%), Postives = 75/106 (70.75%), Query Frame = 0
BLAST of Pay0004383 vs. ExPASy TrEMBL
Match: A0A6J1B6U9 (uncharacterized protein LOC110424651 OS=Herrania umbratica OX=108875 GN=LOC110424651 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 2.9e-24 Identity = 62/121 (51.24%), Postives = 77/121 (63.64%), Query Frame = 0
BLAST of Pay0004383 vs. NCBI nr
Match: TYK12988.1 (uncharacterized protein E5676_scaffold255G005850 [Cucumis melo var. makuwa]) HSP 1 Score: 210.7 bits (535), Expect = 5.7e-51 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Pay0004383 vs. NCBI nr
Match: XP_011658113.1 (uncharacterized protein LOC105435946 [Cucumis sativus] >KGN49041.1 hypothetical protein Csa_003579 [Cucumis sativus]) HSP 1 Score: 190.7 bits (483), Expect = 6.1e-45 Identity = 88/96 (91.67%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of Pay0004383 vs. NCBI nr
Match: XP_038882557.1 (uncharacterized protein LOC120073788 [Benincasa hispida]) HSP 1 Score: 172.2 bits (435), Expect = 2.2e-39 Identity = 82/97 (84.54%), Postives = 85/97 (87.63%), Query Frame = 0
BLAST of Pay0004383 vs. NCBI nr
Match: KAG6603827.1 (hypothetical protein SDJN03_04436, partial [Cucurbita argyrosperma subsp. sororia] >KAG7034009.1 hypothetical protein SDJN02_03735, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 159.5 bits (402), Expect = 1.5e-35 Identity = 77/99 (77.78%), Postives = 84/99 (84.85%), Query Frame = 0
BLAST of Pay0004383 vs. NCBI nr
Match: KAG6594704.1 (hypothetical protein SDJN03_11257, partial [Cucurbita argyrosperma subsp. sororia] >KAG7026671.1 hypothetical protein SDJN02_10674, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 153.3 bits (386), Expect = 1.1e-33 Identity = 74/96 (77.08%), Postives = 78/96 (81.25%), Query Frame = 0
BLAST of Pay0004383 vs. TAIR 10
Match: AT5G55620.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G09950.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 90.9 bits (224), Expect = 6.1e-19 Identity = 38/56 (67.86%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of Pay0004383 vs. TAIR 10
Match: AT3G09950.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G41761.1); Has 128 Blast hits to 128 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 128; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 83.6 bits (205), Expect = 9.8e-17 Identity = 42/77 (54.55%), Postives = 51/77 (66.23%), Query Frame = 0
BLAST of Pay0004383 vs. TAIR 10
Match: AT5G41761.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G55570.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-15 Identity = 41/83 (49.40%), Postives = 55/83 (66.27%), Query Frame = 0
BLAST of Pay0004383 vs. TAIR 10
Match: AT3G55570.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G41761.1); Has 128 Blast hits to 128 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 128; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 77.4 bits (189), Expect = 7.0e-15 Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of Pay0004383 vs. TAIR 10
Match: AT3G11405.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G55570.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 56.2 bits (134), Expect = 1.7e-08 Identity = 29/54 (53.70%), Postives = 34/54 (62.96%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Payzawat) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|