![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
PI0020491 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAAGTTCTGCCGTGACTTCAGTTTTCTGTTATGTTGGTGCTCTTGCTATAATGGGTTCTCTACACCATATTGACAAGGATCTCCTTGGCCACTGGTCATGTGAGCGGCAAGTCAAATCTGGAGGTCCTAGTGGTCGACCCGAGAAACTTCCTGATATGGGTTTGAACTTCTATTACATATCGTAA ATGTCAAGTTCTGCCGTGACTTCAGTTTTCTGTTATGTTGGTGCTCTTGCTATAATGGGTTCTCTACACCATATTGACAAGGATCTCCTTGGCCACTGGTCATGTGAGCGGCAAGTCAAATCTGGAGGTCCTAGTGGTCGACCCGAGAAACTTCCTGATATGGGTTTGAACTTCTATTACATATCGTAA ATGTCAAGTTCTGCCGTGACTTCAGTTTTCTGTTATGTTGGTGCTCTTGCTATAATGGGTTCTCTACACCATATTGACAAGGATCTCCTTGGCCACTGGTCATGTGAGCGGCAAGTCAAATCTGGAGGTCCTAGTGGTCGACCCGAGAAACTTCCTGATATGGGTTTGAACTTCTATTACATATCGTAA MSSSAVTSVFCYVGALAIMGSLHHIDKDLLGHWSCERQVKSGGPSGRPEKLPDMGLNFYYIS Homology
BLAST of PI0020491 vs. ExPASy Swiss-Prot
Match: Q84J75 (Geranylgeranyl transferase type-2 subunit beta 1 OS=Arabidopsis thaliana OX=3702 GN=RGTB1 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 9.7e-15 Identity = 35/61 (57.38%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy Swiss-Prot
Match: Q9LHL5 (Geranylgeranyl transferase type-2 subunit beta 2 OS=Arabidopsis thaliana OX=3702 GN=RGTB2 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.4e-13 Identity = 35/62 (56.45%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy Swiss-Prot
Match: Q5E9B3 (Geranylgeranyl transferase type-2 subunit beta OS=Bos taurus OX=9913 GN=RABGGTB PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 2.9e-11 Identity = 29/61 (47.54%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy Swiss-Prot
Match: P53611 (Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 2.9e-11 Identity = 29/61 (47.54%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy Swiss-Prot
Match: P53612 (Geranylgeranyl transferase type-2 subunit beta OS=Mus musculus OX=10090 GN=Rabggtb PE=1 SV=2) HSP 1 Score: 68.6 bits (166), Expect = 2.9e-11 Identity = 29/61 (47.54%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy TrEMBL
Match: A0A5A7SQ05 (Geranylgeranyl transferase type-2 subunit beta-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G003910 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 1.4e-16 Identity = 44/55 (80.00%), Postives = 47/55 (85.45%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy TrEMBL
Match: A0A438GJW4 (Geranylgeranyl transferase type-2 subunit beta 1 OS=Vitis vinifera OX=29760 GN=RGTB1_0 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 2.7e-15 Identity = 39/57 (68.42%), Postives = 49/57 (85.96%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy TrEMBL
Match: A0A7C9A538 (Geranylgeranyl transferase type-2 subunit beta OS=Opuntia streptacantha OX=393608 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 2.7e-15 Identity = 39/54 (72.22%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy TrEMBL
Match: A0A7C9A5M7 (Geranylgeranyl transferase type-2 subunit beta OS=Opuntia streptacantha OX=393608 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 2.7e-15 Identity = 39/54 (72.22%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of PI0020491 vs. ExPASy TrEMBL
Match: A0A7C9A7A9 (Geranylgeranyl transferase type-2 subunit beta OS=Opuntia streptacantha OX=393608 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 2.7e-15 Identity = 39/54 (72.22%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of PI0020491 vs. NCBI nr
Match: KAA0031621.1 (geranylgeranyl transferase type-2 subunit beta-like [Cucumis melo var. makuwa] >TYK07073.1 geranylgeranyl transferase type-2 subunit beta-like [Cucumis melo var. makuwa]) HSP 1 Score: 94.7 bits (234), Expect = 2.9e-16 Identity = 44/55 (80.00%), Postives = 47/55 (85.45%), Query Frame = 0
BLAST of PI0020491 vs. NCBI nr
Match: XP_038887312.1 (geranylgeranyl transferase type-2 subunit beta 1-like isoform X3 [Benincasa hispida]) HSP 1 Score: 90.9 bits (224), Expect = 4.2e-15 Identity = 40/54 (74.07%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of PI0020491 vs. NCBI nr
Match: XP_038887307.1 (geranylgeranyl transferase type-2 subunit beta 1-like isoform X1 [Benincasa hispida] >XP_038887308.1 geranylgeranyl transferase type-2 subunit beta 1-like isoform X1 [Benincasa hispida] >XP_038887309.1 geranylgeranyl transferase type-2 subunit beta 1-like isoform X1 [Benincasa hispida]) HSP 1 Score: 90.9 bits (224), Expect = 4.2e-15 Identity = 40/54 (74.07%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of PI0020491 vs. NCBI nr
Match: XP_038887310.1 (geranylgeranyl transferase type-2 subunit beta 1-like isoform X2 [Benincasa hispida] >XP_038887311.1 geranylgeranyl transferase type-2 subunit beta 1-like isoform X2 [Benincasa hispida]) HSP 1 Score: 90.9 bits (224), Expect = 4.2e-15 Identity = 40/54 (74.07%), Postives = 47/54 (87.04%), Query Frame = 0
BLAST of PI0020491 vs. NCBI nr
Match: RVW72500.1 (Geranylgeranyl transferase type-2 subunit beta 1 [Vitis vinifera]) HSP 1 Score: 90.5 bits (223), Expect = 5.5e-15 Identity = 39/57 (68.42%), Postives = 49/57 (85.96%), Query Frame = 0
BLAST of PI0020491 vs. TAIR 10
Match: AT5G12210.1 (RAB geranylgeranyl transferase beta subunit 1 ) HSP 1 Score: 80.1 bits (196), Expect = 6.9e-16 Identity = 35/61 (57.38%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of PI0020491 vs. TAIR 10
Match: AT5G12210.2 (RAB geranylgeranyl transferase beta subunit 1 ) HSP 1 Score: 80.1 bits (196), Expect = 6.9e-16 Identity = 35/61 (57.38%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of PI0020491 vs. TAIR 10
Match: AT3G12070.1 (RAB geranylgeranyl transferase beta subunit 2 ) HSP 1 Score: 75.5 bits (184), Expect = 1.7e-14 Identity = 35/62 (56.45%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of PI0020491 vs. TAIR 10
Match: AT3G12070.2 (RAB geranylgeranyl transferase beta subunit 2 ) HSP 1 Score: 75.5 bits (184), Expect = 1.7e-14 Identity = 35/62 (56.45%), Postives = 46/62 (74.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|