
PI0019775 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGTTCTGGACCTTCTTTCAAGGGATTCTGCTGTTTACAAATGCCTTTGCAATTCTGAACGAAGATCGTTTTCTTGCTCGGAGAGGATGGACATTAGCAGAGATGTCGAGAGAAAGAAGAAGCACGCTCAAAGGCCAGGTAATTGGGCTCATCCATGCATGTCAATTCTTGAGACTTCCACTCATTCTTTTCAATATCATCACCATCATCGTCAAGCTCTTCTCTGGTTGA ATGTGGTTCTGGACCTTCTTTCAAGGGATTCTGCTGTTTACAAATGCCTTTGCAATTCTGAACGAAGATCGTTTTCTTGCTCGGAGAGGATGGACATTAGCAGAGATGTCGAGAGAAAGAAGAAGCACGCTCAAAGGCCAGGTAATTGGGCTCATCCATGCATGTCAATTCTTGAGACTTCCACTCATTCTTTTCAATATCATCACCATCATCGTCAAGCTCTTCTCTGGTTGA ATGTGGTTCTGGACCTTCTTTCAAGGGATTCTGCTGTTTACAAATGCCTTTGCAATTCTGAACGAAGATCGTTTTCTTGCTCGGAGAGGATGGACATTAGCAGAGATGTCGAGAGAAAGAAGAAGCACGCTCAAAGGCCAGGTAATTGGGCTCATCCATGCATGTCAATTCTTGAGACTTCCACTCATTCTTTTCAATATCATCACCATCATCGTCAAGCTCTTCTCTGGTTGA MWFWTFFQGILLFTNAFAILNEDRFLARRGWTLAEMSRERRSTLKGQVIGLIHACQFLRLPLILFNIITIIVKLFSG Homology
BLAST of PI0019775 vs. ExPASy Swiss-Prot
Match: O13825 (Protein transport protein yos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yos1 PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.3e-04 Identity = 30/70 (42.86%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of PI0019775 vs. ExPASy TrEMBL
Match: A0A1S3B5S0 (protein transport protein yos1-like OS=Cucumis melo OX=3656 GN=LOC103486333 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 7.1e-34 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of PI0019775 vs. ExPASy TrEMBL
Match: A0A6J1J7W2 (protein transport protein yos1-like OS=Cucurbita maxima OX=3661 GN=LOC111482074 PE=3 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 3.4e-28 Identity = 66/77 (85.71%), Postives = 72/77 (93.51%), Query Frame = 0
BLAST of PI0019775 vs. ExPASy TrEMBL
Match: A0A6J1F388 (protein transport protein yos1-like OS=Cucurbita moschata OX=3662 GN=LOC111441969 PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 9.9e-28 Identity = 65/77 (84.42%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of PI0019775 vs. ExPASy TrEMBL
Match: A0A6J1CWU4 (protein transport protein yos1-like OS=Momordica charantia OX=3673 GN=LOC111015136 PE=3 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 1.1e-26 Identity = 63/77 (81.82%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of PI0019775 vs. ExPASy TrEMBL
Match: A0A6J1FBJ2 (immediate early response 3-interacting protein 1-like OS=Cucurbita moschata OX=3662 GN=LOC111442599 PE=3 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 1.4e-26 Identity = 64/77 (83.12%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of PI0019775 vs. NCBI nr
Match: XP_008442479.1 (PREDICTED: protein transport protein yos1-like [Cucumis melo]) HSP 1 Score: 152.5 bits (384), Expect = 1.5e-33 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of PI0019775 vs. NCBI nr
Match: XP_004137742.1 (protein transport protein yos1-like [Cucumis sativus]) HSP 1 Score: 148.7 bits (374), Expect = 2.1e-32 Identity = 75/77 (97.40%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of PI0019775 vs. NCBI nr
Match: XP_038906232.1 (protein transport protein yos1-like [Benincasa hispida] >XP_038906233.1 protein transport protein yos1-like [Benincasa hispida]) HSP 1 Score: 137.9 bits (346), Expect = 3.7e-29 Identity = 69/77 (89.61%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of PI0019775 vs. NCBI nr
Match: XP_022983483.1 (protein transport protein yos1-like [Cucurbita maxima] >XP_022983485.1 protein transport protein yos1-like [Cucurbita maxima]) HSP 1 Score: 133.7 bits (335), Expect = 7.0e-28 Identity = 66/77 (85.71%), Postives = 72/77 (93.51%), Query Frame = 0
BLAST of PI0019775 vs. NCBI nr
Match: XP_022934956.1 (protein transport protein yos1-like [Cucurbita moschata] >XP_023527548.1 protein transport protein yos1-like [Cucurbita pepo subsp. pepo] >XP_023527549.1 protein transport protein yos1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 132.1 bits (331), Expect = 2.0e-27 Identity = 65/77 (84.42%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of PI0019775 vs. TAIR 10
Match: AT2G37975.1 (Yos1-like protein ) HSP 1 Score: 107.5 bits (267), Expect = 5.0e-24 Identity = 52/78 (66.67%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of PI0019775 vs. TAIR 10
Match: AT3G54085.1 (Yos1-like protein ) HSP 1 Score: 99.8 bits (247), Expect = 1.0e-21 Identity = 49/78 (62.82%), Postives = 62/78 (79.49%), Query Frame = 0
BLAST of PI0019775 vs. TAIR 10
Match: AT3G54085.2 (Yos1-like protein ) HSP 1 Score: 99.8 bits (247), Expect = 1.0e-21 Identity = 49/78 (62.82%), Postives = 62/78 (79.49%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|