PI0013116 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGCCGTGTTCAACCTTGTTTTGATCGAAGACTCTGTTATCGGGAAATCGAAGCTCCTCTTGCCATTCCATCGGAATGAGATTGATGTTAACTACAAGGCCTCAATCGGCGTCGAGTTTCAGATTCAAGTGCTGAAAATCAATGGCAAAGAGGTTAAGTCTCTCATGTGAGACTTTTGTTTCTTCATCTTATGTCTTTTAATCTAAAATTTATCCCTCGTTTCATTTGTTCGATGCCATCTGAGGATTTCTCTTCCCTAATGTTTCCACTGATCCAGATTTCAAAATAGGGGATTCTTGTATGATGGGTTTTGGTGGAGGAATCCCCAAACAAAAAAAAAATACCTTTTAATAATCCCTTAACCCGAAGATTGGTTGGATTATTTTTTTCAAGTTCCAGTTTTTTCATTTAGGTGATGAAGTTTTTCCTCTCTTTGGTTGCAGTATGAAGGAGATATGAAAAGGATGAACATATTTCGCTGGCGAAATGTGCACTTTATAATTGTTCCAAGCTTGAGGAAATGA ATGGTGGCCGTGTTCAACCTTGTTTTGATCGAAGACTCTGTTATCGGGAAATCGAAGCTCCTCTTGCCATTCCATCGGAATGAGATTGATGTTAACTACAAGGCCTCAATCGGCGTCGAGTTTCAGATTCAAGTGCTGAAAATCAATGGCAAAGAGTATGAAGGAGATATGAAAAGGATGAACATATTTCGCTGGCGAAATGTGCACTTTATAATTGTTCCAAGCTTGAGGAAATGA ATGGTGGCCGTGTTCAACCTTGTTTTGATCGAAGACTCTGTTATCGGGAAATCGAAGCTCCTCTTGCCATTCCATCGGAATGAGATTGATGTTAACTACAAGGCCTCAATCGGCGTCGAGTTTCAGATTCAAGTGCTGAAAATCAATGGCAAAGAGTATGAAGGAGATATGAAAAGGATGAACATATTTCGCTGGCGAAATGTGCACTTTATAATTGTTCCAAGCTTGAGGAAATGA MVAVFNLVLIEDSVIGKSKLLLPFHRNEIDVNYKASIGVEFQIQVLKINGKEYEGDMKRMNIFRWRNVHFIIVPSLRK Homology
BLAST of PI0013116 vs. ExPASy Swiss-Prot
Match: Q9SRS5 (Ras-related protein RABA5b OS=Arabidopsis thaliana OX=3702 GN=RABA5B PE=1 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.0e-08 Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy Swiss-Prot
Match: P19892 (Ras-related protein RABA5e OS=Arabidopsis thaliana OX=3702 GN=RABA5E PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.4e-07 Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy Swiss-Prot
Match: P28187 (Ras-related protein RABA5c OS=Arabidopsis thaliana OX=3702 GN=RABA5C PE=1 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.9e-07 Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy Swiss-Prot
Match: Q9FGK5 (Ras-related protein RABA5a OS=Arabidopsis thaliana OX=3702 GN=RABA5A PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.5e-07 Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy Swiss-Prot
Match: Q9SIP0 (Ras-related protein RABA5d OS=Arabidopsis thaliana OX=3702 GN=RABA5D PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.2e-07 Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy TrEMBL
Match: A0A0A0KVZ8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G011610 PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.7e-14 Identity = 48/69 (69.57%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy TrEMBL
Match: A0A5A7TT53 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold46G002930 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 5.9e-12 Identity = 43/59 (72.88%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy TrEMBL
Match: A0A5D3D0L2 (Ras-related protein RABA5b-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold130G001860 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 1.0e-11 Identity = 43/58 (74.14%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy TrEMBL
Match: A0A7J9KE47 (Uncharacterized protein OS=Gossypium armourianum OX=34283 GN=Goarm_005829 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 2.6e-07 Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of PI0013116 vs. ExPASy TrEMBL
Match: A0A445BSW9 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A07g035319 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 5.7e-07 Identity = 31/54 (57.41%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of PI0013116 vs. NCBI nr
Match: KGN53014.1 (hypothetical protein Csa_015426 [Cucumis sativus]) HSP 1 Score: 88.2 bits (217), Expect = 3.4e-14 Identity = 48/69 (69.57%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of PI0013116 vs. NCBI nr
Match: KAA0044545.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 79.7 bits (195), Expect = 1.2e-11 Identity = 43/59 (72.88%), Postives = 49/59 (83.05%), Query Frame = 0
BLAST of PI0013116 vs. NCBI nr
Match: TYK17038.1 (ras-related protein RABA5b-like [Cucumis melo var. makuwa]) HSP 1 Score: 79.0 bits (193), Expect = 2.1e-11 Identity = 43/58 (74.14%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of PI0013116 vs. NCBI nr
Match: MBA0844539.1 (hypothetical protein [Gossypium armourianum]) HSP 1 Score: 64.3 bits (155), Expect = 5.3e-07 Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of PI0013116 vs. NCBI nr
Match: XP_021907378.1 (ras-related protein RABA5b [Carica papaya]) HSP 1 Score: 64.3 bits (155), Expect = 5.3e-07 Identity = 31/54 (57.41%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of PI0013116 vs. TAIR 10
Match: AT3G07410.1 (RAB GTPase homolog A5B ) HSP 1 Score: 60.5 bits (145), Expect = 7.1e-10 Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of PI0013116 vs. TAIR 10
Match: AT1G05810.1 (RAB GTPase homolog A5E ) HSP 1 Score: 56.6 bits (135), Expect = 1.0e-08 Identity = 27/54 (50.00%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of PI0013116 vs. TAIR 10
Match: AT2G43130.1 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 56.2 bits (134), Expect = 1.3e-08 Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 0
BLAST of PI0013116 vs. TAIR 10
Match: AT5G47520.1 (RAB GTPase homolog A5A ) HSP 1 Score: 55.8 bits (133), Expect = 1.8e-08 Identity = 28/54 (51.85%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of PI0013116 vs. TAIR 10
Match: AT2G31680.1 (RAB GTPase homolog A5D ) HSP 1 Score: 55.1 bits (131), Expect = 3.0e-08 Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|