PI0008756 (gene) Melon (PI 482460) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAGGAAAAGTTTAATTCAGAGGGAGAAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCGATCCTTAAAAAAAGAAATAAGCAAAGTTCCATCGTTGAGTGATAAATGGGAAATTCATGGAAAGTTACAATCCCCACCGCGTAATAGTGCACCCACACGTCTTCATCGACGTTGTTTTTTAACCGGAAGACCGAGAGCTAACTATCGAGACTTTGGGCTTTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCCTGGGGCAACAAGATCAAGTTGGTAA ATGGCAAGGAAAAGTTTAATTCAGAGGGAGAAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCGATCCTTAAAAAAAGAAATAAGCAAAGTTCCATCGTTGAGTGATAAATGGGAAATTCATGGAAAGTTACAATCCCCACCGCGTAATAGTGCACCCACACGTCTTCATCGACGTTGTTTTTTAACCGGAAGACCGAGAGCTAACTATCGAGACTTTGGGCTTTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCCTGGGGCAACAAGATCAAGTTGGTAA ATGGCAAGGAAAAGTTTAATTCAGAGGGAGAAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCGATCCTTAAAAAAAGAAATAAGCAAAGTTCCATCGTTGAGTGATAAATGGGAAATTCATGGAAAGTTACAATCCCCACCGCGTAATAGTGCACCCACACGTCTTCATCGACGTTGTTTTTTAACCGGAAGACCGAGAGCTAACTATCGAGACTTTGGGCTTTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCCTGGGGCAACAAGATCAAGTTGGTAA MARKSLIQREKKRQKLEQKYHLIRRSLKKEISKVPSLSDKWEIHGKLQSPPRNSAPTRLHRRCFLTGRPRANYRDFGLSGHILREMVHACLLPGATRSSW Homology
BLAST of PI0008756 vs. ExPASy Swiss-Prot
Match: Q4VZN5 (30S ribosomal protein S14, chloroplastic OS=Cucumis sativus OX=3659 GN=rps14 PE=3 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 3.0e-50 Identity = 97/100 (97.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy Swiss-Prot
Match: B1NWE8 (30S ribosomal protein S14, chloroplastic OS=Manihot esculenta OX=3983 GN=rps14 PE=3 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 5.2e-50 Identity = 97/100 (97.00%), Postives = 98/100 (98.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy Swiss-Prot
Match: A6MM34 (30S ribosomal protein S14, chloroplastic OS=Buxus microphylla OX=153571 GN=rps14 PE=3 SV=1) HSP 1 Score: 197.6 bits (501), Expect = 6.7e-50 Identity = 97/100 (97.00%), Postives = 98/100 (98.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy Swiss-Prot
Match: Q3C1I0 (30S ribosomal protein S14, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=rps14 PE=3 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 1.1e-49 Identity = 97/100 (97.00%), Postives = 98/100 (98.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy Swiss-Prot
Match: Q33C38 (30S ribosomal protein S14, chloroplastic OS=Nicotiana tomentosiformis OX=4098 GN=rps14 PE=3 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 1.1e-49 Identity = 97/100 (97.00%), Postives = 98/100 (98.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy TrEMBL
Match: A0A6H0EVF7 (30S ribosomal protein S14, chloroplastic OS=Momordica sessilifolia OX=703387 GN=rps14 PE=3 SV=1) HSP 1 Score: 203.8 bits (517), Expect = 3.5e-49 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy TrEMBL
Match: A0A6H0ESP9 (30S ribosomal protein S14, chloroplastic OS=Trichosanthes kirilowii OX=3677 GN=rps14 PE=3 SV=1) HSP 1 Score: 202.2 bits (513), Expect = 1.0e-48 Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy TrEMBL
Match: A0A1P8LE66 (Ribosomal protein S14 OS=Citrullus mucosospermus OX=519315 GN=rps14 PE=3 SV=1) HSP 1 Score: 202.2 bits (513), Expect = 1.0e-48 Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy TrEMBL
Match: A0A6M3RTR8 (30S ribosomal protein S14, chloroplastic OS=Trichosanthes kirilowii var. japonica OX=61011 GN=rps14 PE=3 SV=1) HSP 1 Score: 202.2 bits (513), Expect = 1.0e-48 Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of PI0008756 vs. ExPASy TrEMBL
Match: A0A2Z2CGL0 (30S ribosomal protein S14, chloroplastic OS=Coccinia grandis OX=387127 GN=rps14 PE=3 SV=1) HSP 1 Score: 202.2 bits (513), Expect = 1.0e-48 Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of PI0008756 vs. NCBI nr
Match: YP_009752918.1 (ribosomal protein S14 [Momordica sessilifolia] >QIT05990.1 ribosomal protein S14 [Momordica sessilifolia]) HSP 1 Score: 203.8 bits (517), Expect = 7.2e-49 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of PI0008756 vs. NCBI nr
Match: YP_009317384.1 (ribosomal protein S14 [Coccinia grandis] >YP_009325987.1 ribosomal protein S14 [Citrullus lanatus] >YP_009348029.1 ribosomal protein S14 [Citrullus mucosospermus] >YP_009420792.1 ribosomal protein S14 [Citrullus colocynthis] >YP_009431555.1 ribosomal protein S14 [Citrullus amarus] >YP_009431640.1 ribosomal protein S14 [Citrullus rehmii] >YP_009456144.1 ribosomal protein S14 [Lagenaria siceraria] >YP_009525184.1 ribosomal protein S14 [Hodgsonia macrocarpa] >YP_009751651.1 ribosomal protein S14 [Hodgsonia heteroclita] >YP_009751904.1 ribosomal protein S14 [Cyclanthera pedata] >YP_009752073.1 ribosomal protein S14 [Dendrosicyos socotranus] >YP_009752157.1 ribosomal protein S14 [Linnaeosicyos amara] >YP_009752494.1 ribosomal protein S14 [Trichosanthes tubiflora] >YP_009752579.1 ribosomal protein S14 [Trichosanthes homophylla] >YP_009753087.1 ribosomal protein S14 [Corallocarpus boehmii] >YP_009753172.1 ribosomal protein S14 [Trichosanthes truncata] >YP_009753256.1 ribosomal protein S14 [Nothoalsomitra suberosa] >YP_010131092.1 ribosomal protein S14 [Benincasa hispida] >APW82459.1 ribosomal protein S14 [Citrullus lanatus subsp. vulgaris] >QHB75961.1 ribosomal protein S14 [Cucumis melo subsp. melo] >QIT04048.1 ribosomal protein S14 [Luffa aegyptiaca] >QIT05060.1 ribosomal protein S14 [Trichosanthes kirilowii] >QJD26469.1 ribosomal protein S14 [Trichosanthes kirilowii var. japonica] >QKX48471.1 ribosomal protein S14 [Luffa acutangula] >QZL38679.1 ribosomal protein S14 [Citrullus ecirrhosus]) HSP 1 Score: 202.2 bits (513), Expect = 2.1e-48 Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of PI0008756 vs. NCBI nr
Match: YP_009255604.1 (ribosomal protein S14 [Cornus controversa] >YP_009652016.1 ribosomal protein S14 [Cornus officinalis] >YP_009696752.1 ribosomal protein S14 [Cornus macrophylla] >YP_009696837.1 ribosomal protein S14 [Cornus oblonga] >YP_009696922.1 ribosomal protein S14 [Cornus alternifolia] >YP_009697007.1 ribosomal protein S14 [Cornus volkensii] >YP_009697092.1 ribosomal protein S14 [Cornus sessilis] >YP_009697177.1 ribosomal protein S14 [Cornus chinensis] >YP_009697262.1 ribosomal protein S14 [Cornus eydeana] >YP_009697347.1 ribosomal protein S14 [Cornus sanguinea] >YP_009697432.1 ribosomal protein S14 [Cornus kousa] >YP_009697517.1 ribosomal protein S14 [Cornus disciflora] >YP_009697601.1 ribosomal protein S14 [Cornus florida] >YP_009697771.1 ribosomal protein S14 [Cornus canadensis] >YP_009697855.1 ribosomal protein S14 [Cornus suecica] >YP_009697939.1 ribosomal protein S14 [Cornus unalaschkensis] >YP_009698023.1 ribosomal protein S14 [Cornus peruviana] >YP_009711394.1 30S ribosomal protein S14 [Homalium paniculiflorum] >YP_009711475.1 30S ribosomal protein S14 [Homalium stenophyllum] >YP_009726447.1 ribosomal protein S14 [Flacourtia rukam] >YP_009729560.1 ribosomal protein S14 [Homalium cochinchinense] >YP_010127044.1 ribosomal protein S14 [Cornus elliptica] >YP_010145800.1 ribosomal protein S14 [Xylosma longifolia] >AUF33155.1 ribosomal protein S14 [Cornus capitata] >QEJ84722.1 ribosomal protein S14 [Cornus florida var. urbiniana] >QGU83809.1 ribosomal protein S14 [Xylosma congesta] >QGU83895.1 ribosomal protein S14 [Homalium racemosum] >QGU83980.1 ribosomal protein S14 [Dovyalis caffra] >QGU84067.1 ribosomal protein S14 [Flacourtia inermis] >QGU84495.1 ribosomal protein S14 [Scolopia saeva] >QGU84581.1 ribosomal protein S14 [Scolopia chinensis] >QSV08619.1 ribosomal protein S14 [Cornus alba]) HSP 1 Score: 201.4 bits (511), Expect = 3.6e-48 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of PI0008756 vs. NCBI nr
Match: YP_008081363.1 (ribosomal protein S14 [Tetracentron sinense] >AGJ72055.1 ribosomal protein S14 [Tetracentron sinense] >QNQ65583.1 ribosomal protein S14 [Tetracentron sinense]) HSP 1 Score: 201.4 bits (511), Expect = 3.6e-48 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of PI0008756 vs. NCBI nr
Match: QZL38591.1 (ribosomal protein S14 [Citrullus naudinianus]) HSP 1 Score: 201.1 bits (510), Expect = 4.6e-48 Identity = 98/100 (98.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of PI0008756 vs. TAIR 10
Match: ATCG00330.1 (chloroplast ribosomal protein S14 ) HSP 1 Score: 187.6 bits (475), Expect = 4.9e-48 Identity = 91/100 (91.00%), Postives = 96/100 (96.00%), Query Frame = 0
BLAST of PI0008756 vs. TAIR 10
Match: AT2G34520.1 (mitochondrial ribosomal protein S14 ) HSP 1 Score: 46.2 bits (108), Expect = 1.8e-05 Identity = 33/93 (35.48%), Postives = 45/93 (48.39%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (PI 482460) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|