
Moc08g45270 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGAAACCATGAGATCAGCTTCAGCAAGCTTCATCAACATTGAACAAATGTTCGATCTCGACACCGTTCTCACCGGAGCCGACGACTTCGGCTACTACGACGACATCGTCATCCCGGCGCCGCCATCAGTGGTGGTCGCCGCCTTGCCGACGGTCACCGCCGACGACATATGTGCTGTCTGCATGGAGGATTTCCGGCCGGACGAATCCGGTAAACAGATCCGCTGCGGCCATGTTTACCACGAAATTTGCATATCCTCGTGGCTCTCCGTCGGCGACTGCTGCCCTCTCTGCCGCCGCCATATCTCCTCCGGCGACAAGGCGGAGGCGCTGAAGACCGTACAAGTTTAG ATGGCTGAAACCATGAGATCAGCTTCAGCAAGCTTCATCAACATTGAACAAATGTTCGATCTCGACACCGTTCTCACCGGAGCCGACGACTTCGGCTACTACGACGACATCGTCATCCCGGCGCCGCCATCAGTGGTGGTCGCCGCCTTGCCGACGGTCACCGCCGACGACATATGTGCTGTCTGCATGGAGGATTTCCGGCCGGACGAATCCGGTAAACAGATCCGCTGCGGCCATGTTTACCACGAAATTTGCATATCCTCGTGGCTCTCCGTCGGCGACTGCTGCCCTCTCTGCCGCCGCCATATCTCCTCCGGCGACAAGGCGGAGGCGCTGAAGACCGTACAAGTTTAG ATGGCTGAAACCATGAGATCAGCTTCAGCAAGCTTCATCAACATTGAACAAATGTTCGATCTCGACACCGTTCTCACCGGAGCCGACGACTTCGGCTACTACGACGACATCGTCATCCCGGCGCCGCCATCAGTGGTGGTCGCCGCCTTGCCGACGGTCACCGCCGACGACATATGTGCTGTCTGCATGGAGGATTTCCGGCCGGACGAATCCGGTAAACAGATCCGCTGCGGCCATGTTTACCACGAAATTTGCATATCCTCGTGGCTCTCCGTCGGCGACTGCTGCCCTCTCTGCCGCCGCCATATCTCCTCCGGCGACAAGGCGGAGGCGCTGAAGACCGTACAAGTTTAG MAETMRSASASFINIEQMFDLDTVLTGADDFGYYDDIVIPAPPSVVVAALPTVTADDICAVCMEDFRPDESGKQIRCGHVYHEICISSWLSVGDCCPLCRRHISSGDKAEALKTVQV Homology
BLAST of Moc08g45270 vs. NCBI nr
Match: XP_023537996.1 (E3 ubiquitin-protein ligase RING1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 167.9 bits (424), Expect = 5.1e-38 Identity = 83/119 (69.75%), Postives = 96/119 (80.67%), Query Frame = 0
BLAST of Moc08g45270 vs. NCBI nr
Match: KAA0061529.1 (RING-H2 finger protein ATL5-like [Cucumis melo var. makuwa]) HSP 1 Score: 166.4 bits (420), Expect = 1.5e-37 Identity = 81/117 (69.23%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of Moc08g45270 vs. NCBI nr
Match: XP_022965415.1 (E3 ubiquitin-protein ligase RNF181-like [Cucurbita maxima]) HSP 1 Score: 164.9 bits (416), Expect = 4.3e-37 Identity = 81/119 (68.07%), Postives = 95/119 (79.83%), Query Frame = 0
BLAST of Moc08g45270 vs. NCBI nr
Match: KAG7021303.1 (E3 ubiquitin-protein ligase RING1-like protein, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 163.3 bits (412), Expect = 1.3e-36 Identity = 83/120 (69.17%), Postives = 96/120 (80.00%), Query Frame = 0
BLAST of Moc08g45270 vs. NCBI nr
Match: XP_022938297.1 (E3 ubiquitin-protein ligase RING1-like [Cucurbita moschata]) HSP 1 Score: 162.9 bits (411), Expect = 1.6e-36 Identity = 81/120 (67.50%), Postives = 94/120 (78.33%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy Swiss-Prot
Match: Q6DIP3 (E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis OX=8364 GN=rnf126 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 6.7e-09 Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy Swiss-Prot
Match: Q6IRP0 (E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis OX=8355 GN=rnf126-b PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 8.8e-09 Identity = 32/96 (33.33%), Postives = 51/96 (53.12%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy Swiss-Prot
Match: Q91YL2 (E3 ubiquitin-protein ligase RNF126 OS=Mus musculus OX=10090 GN=Rnf126 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 8.8e-09 Identity = 31/96 (32.29%), Postives = 49/96 (51.04%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy Swiss-Prot
Match: Q9VHI7 (E3 ubiquitin-protein ligase Iruka OS=Drosophila melanogaster OX=7227 GN=Iru PE=1 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.5e-08 Identity = 19/46 (41.30%), Postives = 34/46 (73.91%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy Swiss-Prot
Match: P0CH30 (E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum OX=3635 GN=RING1 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.0e-08 Identity = 21/49 (42.86%), Postives = 31/49 (63.27%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy TrEMBL
Match: A0A5A7V793 (RING-H2 finger protein ATL5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold41G00900 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 7.2e-38 Identity = 81/117 (69.23%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy TrEMBL
Match: A0A6J1HNM2 (E3 ubiquitin-protein ligase RNF181-like OS=Cucurbita maxima OX=3661 GN=LOC111465331 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 2.1e-37 Identity = 81/119 (68.07%), Postives = 95/119 (79.83%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy TrEMBL
Match: A0A6J1FDN7 (E3 ubiquitin-protein ligase RING1-like OS=Cucurbita moschata OX=3662 GN=LOC111444430 PE=4 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 7.9e-37 Identity = 81/120 (67.50%), Postives = 94/120 (78.33%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy TrEMBL
Match: A0A0A0LEZ1 (RING-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G000920 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 5.1e-36 Identity = 78/118 (66.10%), Postives = 91/118 (77.12%), Query Frame = 0
BLAST of Moc08g45270 vs. ExPASy TrEMBL
Match: A0A6J1G511 (E3 ubiquitin-protein ligase RING1-like OS=Cucurbita moschata OX=3662 GN=LOC111450796 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 7.0e-25 Identity = 65/99 (65.66%), Postives = 76/99 (76.77%), Query Frame = 0
BLAST of Moc08g45270 vs. TAIR 10
Match: AT1G68180.1 (RING/U-box superfamily protein ) HSP 1 Score: 67.8 bits (164), Expect = 6.7e-12 Identity = 27/73 (36.99%), Postives = 43/73 (58.90%), Query Frame = 0
BLAST of Moc08g45270 vs. TAIR 10
Match: AT3G60080.1 (RING/U-box superfamily protein ) HSP 1 Score: 59.3 bits (142), Expect = 2.4e-09 Identity = 27/69 (39.13%), Postives = 40/69 (57.97%), Query Frame = 0
BLAST of Moc08g45270 vs. TAIR 10
Match: AT3G19950.1 (RING/U-box superfamily protein ) HSP 1 Score: 57.8 bits (138), Expect = 6.9e-09 Identity = 28/76 (36.84%), Postives = 41/76 (53.95%), Query Frame = 0
BLAST of Moc08g45270 vs. TAIR 10
Match: AT2G44330.1 (RING/U-box superfamily protein ) HSP 1 Score: 57.4 bits (137), Expect = 9.0e-09 Identity = 25/63 (39.68%), Postives = 40/63 (63.49%), Query Frame = 0
BLAST of Moc08g45270 vs. TAIR 10
Match: AT2G39720.1 (RING-H2 finger C2A ) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-08 Identity = 25/77 (32.47%), Postives = 38/77 (49.35%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|