Moc07g02860 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAGAAGAAGATTAATCGCGGCGGCGATCGCAATCGCGGCCGTGACGCTGGCGGCTGCGGCGGAAGGATACGGCGGAAGATTGGGCGGAAGGACGGAGATCGAAGACGTGAGAACGAACGAGGAGGTGCAGGAATTAGGGCGATTCTGCGTGGAGGAGTACAATCGGCGGAGGAACGGCGGCGGAGAGGTGAGATTCAGGGCGGTGGTGGCGGCGGAGAAGCAGGTGGTGGCCGGAATGAAGTATTATCTGAAGATCTCCGGGAGCGTGAAGGGGGAGAGTGAAATGTTGTTCGATTCGATCGTGATTGTGAAGCCCTGGCTTCGCTCTAAGCAACTCCTCCATTTTTCGCCCTCCACAATTTTGATCGCCAACAAATTTTGA ATGGCGAGAAGAAGATTAATCGCGGCGGCGATCGCAATCGCGGCCGTGACGCTGGCGGCTGCGGCGGAAGGATACGGCGGAAGATTGGGCGGAAGGACGGAGATCGAAGACGTGAGAACGAACGAGGAGGTGCAGGAATTAGGGCGATTCTGCGTGGAGGAGTACAATCGGCGGAGGAACGGCGGCGGAGAGGTGAGATTCAGGGCGGTGGTGGCGGCGGAGAAGCAGGTGGTGGCCGGAATGAAGTATTATCTGAAGATCTCCGGGAGCGTGAAGGGGGAGAGTGAAATGTTGTTCGATTCGATCGTGATTGTGAAGCCCTGGCTTCGCTCTAAGCAACTCCTCCATTTTTCGCCCTCCACAATTTTGATCGCCAACAAATTTTGA ATGGCGAGAAGAAGATTAATCGCGGCGGCGATCGCAATCGCGGCCGTGACGCTGGCGGCTGCGGCGGAAGGATACGGCGGAAGATTGGGCGGAAGGACGGAGATCGAAGACGTGAGAACGAACGAGGAGGTGCAGGAATTAGGGCGATTCTGCGTGGAGGAGTACAATCGGCGGAGGAACGGCGGCGGAGAGGTGAGATTCAGGGCGGTGGTGGCGGCGGAGAAGCAGGTGGTGGCCGGAATGAAGTATTATCTGAAGATCTCCGGGAGCGTGAAGGGGGAGAGTGAAATGTTGTTCGATTCGATCGTGATTGTGAAGCCCTGGCTTCGCTCTAAGCAACTCCTCCATTTTTCGCCCTCCACAATTTTGATCGCCAACAAATTTTGA MARRRLIAAAIAIAAVTLAAAAEGYGGRLGGRTEIEDVRTNEEVQELGRFCVEEYNRRRNGGGEVRFRAVVAAEKQVVAGMKYYLKISGSVKGESEMLFDSIVIVKPWLRSKQLLHFSPSTILIANKF Homology
BLAST of Moc07g02860 vs. NCBI nr
Match: XP_022150412.1 (cysteine proteinase inhibitor B [Momordica charantia]) HSP 1 Score: 240.4 bits (612), Expect = 8.8e-60 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Moc07g02860 vs. NCBI nr
Match: XP_004138536.1 (cysteine proteinase inhibitor B [Cucumis sativus] >KGN45922.1 hypothetical protein Csa_005586 [Cucumis sativus]) HSP 1 Score: 145.6 bits (366), Expect = 3.0e-31 Identity = 77/122 (63.11%), Postives = 96/122 (78.69%), Query Frame = 0
BLAST of Moc07g02860 vs. NCBI nr
Match: XP_008465470.1 (PREDICTED: cysteine proteinase inhibitor B [Cucumis melo]) HSP 1 Score: 143.3 bits (360), Expect = 1.5e-30 Identity = 77/122 (63.11%), Postives = 95/122 (77.87%), Query Frame = 0
BLAST of Moc07g02860 vs. NCBI nr
Match: XP_038886316.1 (cysteine proteinase inhibitor 4 [Benincasa hispida]) HSP 1 Score: 142.5 bits (358), Expect = 2.5e-30 Identity = 75/117 (64.10%), Postives = 94/117 (80.34%), Query Frame = 0
BLAST of Moc07g02860 vs. NCBI nr
Match: XP_023513886.1 (cysteine proteinase inhibitor B [Cucurbita pepo subsp. pepo]) HSP 1 Score: 134.8 bits (338), Expect = 5.2e-28 Identity = 75/125 (60.00%), Postives = 96/125 (76.80%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy Swiss-Prot
Match: Q5N806 (Cysteine proteinase inhibitor 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0915200 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.8e-21 Identity = 55/107 (51.40%), Postives = 77/107 (71.96%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy Swiss-Prot
Match: Q0JGM8 (Cysteine proteinase inhibitor 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0915401 PE=3 SV=2) HSP 1 Score: 95.9 bits (237), Expect = 3.5e-19 Identity = 58/132 (43.94%), Postives = 86/132 (65.15%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy Swiss-Prot
Match: Q10993 (Cysteine proteinase inhibitor B OS=Helianthus annuus OX=4232 PE=1 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 3.5e-19 Identity = 46/97 (47.42%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy Swiss-Prot
Match: Q8L5T9 (Cysteine proteinase inhibitor 2 OS=Arabidopsis thaliana OX=3702 GN=CYS2 PE=2 SV=2) HSP 1 Score: 94.7 bits (234), Expect = 7.9e-19 Identity = 47/106 (44.34%), Postives = 73/106 (68.87%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy Swiss-Prot
Match: A2XS65 (Cysteine proteinase inhibitor 10 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_014908 PE=3 SV=2) HSP 1 Score: 89.7 bits (221), Expect = 2.5e-17 Identity = 56/133 (42.11%), Postives = 80/133 (60.15%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy TrEMBL
Match: A0A6J1DAN3 (cysteine proteinase inhibitor B OS=Momordica charantia OX=3673 GN=LOC111018574 PE=4 SV=1) HSP 1 Score: 240.4 bits (612), Expect = 4.3e-60 Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy TrEMBL
Match: A0A0A0KC20 (Cystatin OS=Cucumis sativus OX=3659 GN=Csa_6G022340 PE=4 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 1.4e-31 Identity = 77/122 (63.11%), Postives = 96/122 (78.69%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy TrEMBL
Match: A0A1S3CPD1 (cysteine proteinase inhibitor B OS=Cucumis melo OX=3656 GN=LOC103503076 PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 7.1e-31 Identity = 77/122 (63.11%), Postives = 95/122 (77.87%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy TrEMBL
Match: A0A5N5HJ78 (Cysteine proteinase inhibitor B-like OS=Pyrus ussuriensis x Pyrus communis OX=2448454 GN=D8674_025466 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 3.7e-27 Identity = 70/113 (61.95%), Postives = 88/113 (77.88%), Query Frame = 0
BLAST of Moc07g02860 vs. ExPASy TrEMBL
Match: A0A5N5H943 (Cysteine proteinase inhibitor B OS=Pyrus ussuriensis x Pyrus communis OX=2448454 GN=D8674_025265 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 6.2e-27 Identity = 70/113 (61.95%), Postives = 88/113 (77.88%), Query Frame = 0
BLAST of Moc07g02860 vs. TAIR 10
Match: AT2G31980.1 (PHYTOCYSTATIN 2 ) HSP 1 Score: 94.7 bits (234), Expect = 5.6e-20 Identity = 47/106 (44.34%), Postives = 73/106 (68.87%), Query Frame = 0
BLAST of Moc07g02860 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 59.7 bits (143), Expect = 2.0e-09 Identity = 32/93 (34.41%), Postives = 56/93 (60.22%), Query Frame = 0
BLAST of Moc07g02860 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 58.5 bits (140), Expect = 4.4e-09 Identity = 39/115 (33.91%), Postives = 65/115 (56.52%), Query Frame = 0
BLAST of Moc07g02860 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 57.4 bits (137), Expect = 9.9e-09 Identity = 33/93 (35.48%), Postives = 57/93 (61.29%), Query Frame = 0
BLAST of Moc07g02860 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 57.4 bits (137), Expect = 9.9e-09 Identity = 33/93 (35.48%), Postives = 57/93 (61.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|