Moc05g08610 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAGGTAAAAAATATTTTCTTGTGTTGGATGATGTTTGGAATGAAAATCCTTCTTTGTGGATTGAGTTGAAAAATTGTTTACTGAGGATCACTGCAAAATCTGGAAATAGTATTATTGTGACTACAAGGAATGTTGAAGTTGGAAAAATCATGGAGACACTTCCTAGCCATCATTTGGTAAAATTATCTGATGAGCAGTGTTGGTATTTGTTCAAACAAAGTGCAAATGTAAATGAATTACCGATGACTCTTGAGTTGAAGGATATTAAAAAAGAGTTGGTGAAAAAGTTTGGTGGTGTACCATTGGTTGCAAGAGTTTTAGGAGGGGCACTAAAATTTGAAGGGTCTATGAGAGATGGCTAA ATGCAAGGTAAAAAATATTTTCTTGTGTTGGATGATGTTTGGAATGAAAATCCTTCTTTGTGGATTGAGTTGAAAAATTGTTTACTGAGGATCACTGCAAAATCTGGAAATAGTATTATTGTGACTACAAGGAATGTTGAAGTTGGAAAAATCATGGAGACACTTCCTAGCCATCATTTGGTAAAATTATCTGATGAGCAGTGTTGGTATTTGTTCAAACAAAGTGCAAATGTAAATGAATTACCGATGACTCTTGAGTTGAAGGATATTAAAAAAGAGTTGGTGAAAAAGTTTGGTGGTGTACCATTGGTTGCAAGAGTTTTAGGAGGGGCACTAAAATTTGAAGGGTCTATGAGAGATGGCTAA ATGCAAGGTAAAAAATATTTTCTTGTGTTGGATGATGTTTGGAATGAAAATCCTTCTTTGTGGATTGAGTTGAAAAATTGTTTACTGAGGATCACTGCAAAATCTGGAAATAGTATTATTGTGACTACAAGGAATGTTGAAGTTGGAAAAATCATGGAGACACTTCCTAGCCATCATTTGGTAAAATTATCTGATGAGCAGTGTTGGTATTTGTTCAAACAAAGTGCAAATGTAAATGAATTACCGATGACTCTTGAGTTGAAGGATATTAAAAAAGAGTTGGTGAAAAAGTTTGGTGGTGTACCATTGGTTGCAAGAGTTTTAGGAGGGGCACTAAAATTTGAAGGGTCTATGAGAGATGGCTAA MQGKKYFLVLDDVWNENPSLWIELKNCLLRITAKSGNSIIVTTRNVEVGKIMETLPSHHLVKLSDEQCWYLFKQSANVNELPMTLELKDIKKELVKKFGGVPLVARVLGGALKFEGSMRDG Homology
BLAST of Moc05g08610 vs. NCBI nr
Match: XP_008453956.1 (PREDICTED: putative disease resistance protein RGA3 isoform X1 [Cucumis melo] >KAA0044619.1 putative disease resistance protein RGA3 isoform X1 [Cucumis melo var. makuwa] >TYK16970.1 putative disease resistance protein RGA3 isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 193.0 bits (489), Expect = 1.5e-45 Identity = 96/117 (82.05%), Postives = 104/117 (88.89%), Query Frame = 0
BLAST of Moc05g08610 vs. NCBI nr
Match: XP_008453957.1 (PREDICTED: putative disease resistance protein RGA3 isoform X2 [Cucumis melo]) HSP 1 Score: 193.0 bits (489), Expect = 1.5e-45 Identity = 96/117 (82.05%), Postives = 104/117 (88.89%), Query Frame = 0
BLAST of Moc05g08610 vs. NCBI nr
Match: XP_031740228.1 (putative disease resistance protein RGA3 isoform X2 [Cucumis sativus]) HSP 1 Score: 183.7 bits (465), Expect = 9.3e-43 Identity = 90/117 (76.92%), Postives = 102/117 (87.18%), Query Frame = 0
BLAST of Moc05g08610 vs. NCBI nr
Match: XP_004152283.3 (putative disease resistance protein RGA3 isoform X1 [Cucumis sativus] >KGN53113.2 hypothetical protein Csa_014548 [Cucumis sativus]) HSP 1 Score: 183.7 bits (465), Expect = 9.3e-43 Identity = 90/117 (76.92%), Postives = 102/117 (87.18%), Query Frame = 0
BLAST of Moc05g08610 vs. NCBI nr
Match: XP_022150842.1 (putative disease resistance protein RGA3 [Momordica charantia]) HSP 1 Score: 181.0 bits (458), Expect = 6.0e-42 Identity = 85/117 (72.65%), Postives = 100/117 (85.47%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy Swiss-Prot
Match: Q7XA40 (Putative disease resistance protein RGA3 OS=Solanum bulbocastanum OX=147425 GN=RGA3 PE=2 SV=2) HSP 1 Score: 113.6 bits (283), Expect = 1.5e-24 Identity = 59/115 (51.30%), Postives = 79/115 (68.70%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy Swiss-Prot
Match: Q7XA42 (Putative disease resistance protein RGA1 OS=Solanum bulbocastanum OX=147425 GN=RGA1 PE=2 SV=2) HSP 1 Score: 107.8 bits (268), Expect = 8.5e-23 Identity = 57/120 (47.50%), Postives = 77/120 (64.17%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy Swiss-Prot
Match: Q7XBQ9 (Disease resistance protein RGA2 OS=Solanum bulbocastanum OX=147425 GN=RGA2 PE=1 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.6e-21 Identity = 57/119 (47.90%), Postives = 74/119 (62.18%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy Swiss-Prot
Match: Q7XA39 (Putative disease resistance protein RGA4 OS=Solanum bulbocastanum OX=147425 GN=RGA4 PE=2 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 2.2e-18 Identity = 53/115 (46.09%), Postives = 70/115 (60.87%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy Swiss-Prot
Match: Q9LRR4 (Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=RPPL1 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 9.1e-17 Identity = 48/117 (41.03%), Postives = 69/117 (58.97%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy TrEMBL
Match: A0A5D3D021 (Putative disease resistance protein RGA3 isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold130G001110 PE=4 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 7.4e-46 Identity = 96/117 (82.05%), Postives = 104/117 (88.89%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy TrEMBL
Match: A0A1S3BYA2 (putative disease resistance protein RGA3 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103494523 PE=4 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 7.4e-46 Identity = 96/117 (82.05%), Postives = 104/117 (88.89%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy TrEMBL
Match: A0A1S3BYQ0 (putative disease resistance protein RGA3 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103494523 PE=4 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 7.4e-46 Identity = 96/117 (82.05%), Postives = 104/117 (88.89%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy TrEMBL
Match: A0A6J1DBV6 (putative disease resistance protein RGA3 OS=Momordica charantia OX=3673 GN=LOC111018890 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 2.9e-42 Identity = 85/117 (72.65%), Postives = 100/117 (85.47%), Query Frame = 0
BLAST of Moc05g08610 vs. ExPASy TrEMBL
Match: A0A0A0KW64 (NB-ARC domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G016430 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 9.4e-41 Identity = 88/117 (75.21%), Postives = 99/117 (84.62%), Query Frame = 0
BLAST of Moc05g08610 vs. TAIR 10
Match: AT3G14470.1 (NB-ARC domain-containing disease resistance protein ) HSP 1 Score: 87.8 bits (216), Expect = 6.5e-18 Identity = 48/117 (41.03%), Postives = 69/117 (58.97%), Query Frame = 0
BLAST of Moc05g08610 vs. TAIR 10
Match: AT3G46730.1 (NB-ARC domain-containing disease resistance protein ) HSP 1 Score: 68.6 bits (166), Expect = 4.1e-12 Identity = 43/113 (38.05%), Postives = 65/113 (57.52%), Query Frame = 0
BLAST of Moc05g08610 vs. TAIR 10
Match: AT3G50950.2 (HOPZ-ACTIVATED RESISTANCE 1 ) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-11 Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 0
BLAST of Moc05g08610 vs. TAIR 10
Match: AT3G50950.1 (HOPZ-ACTIVATED RESISTANCE 1 ) HSP 1 Score: 67.0 bits (162), Expect = 1.2e-11 Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 0
BLAST of Moc05g08610 vs. TAIR 10
Match: AT3G14460.1 (LRR and NB-ARC domains-containing disease resistance protein ) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-11 Identity = 34/115 (29.57%), Postives = 65/115 (56.52%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|