Moc04g33780 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTCTGGAGGAGTTTATACCACCAAACCATGCCAAGACTCATATTTATTCCATGCTCATTAGAACAGCTCTTGTAATTTCCACCTTACTTGTCGGCCTTTCTCTCCCCTTTTTCGGTAAGTTAAGTTTATCTTCACGACTTTATTTCCATACCAATCTATGGTGAAGAAAAAGCTTCATTTTCTTCAATCACCTCTTGGCCTTGGCAAAATGAGTGAATCCTCACTTCCCAATGCAGGTCTTATGATGGCATTGATTGGATCGTTGTTAACAATGCTTGTGGTAAGTCTTTCTTCTGCAATGCAGTAAGTTTACTCGTCCGAGCTCTCGAGATCCTTCATTTCTGGTACTAACTCATTCATTAATGGCTGAACTATCAAATCTGTCTTGCAGACTTTAATACTCCCTTGTGTCTGTTACCTCAGCATTTTGAGGGGGAAAATAACATTTTTGCAGGTAAAAACTTCCTCTGCTTTCAAGAATTCGACTGATCAATTACATAACATCATTTTACGTAAAGACCTTTCTTTTCTTCTTTTTTCTCTACAGAGAGCACTTTGTCTAATAGTTATAACAGTAGGAGTTGTTGCGTCAGCATTTGGATCATATGCATCTCTCGAGAAAATCATTGAGAAATTGATGAGCGGCTGA ATGAGTCTGGAGGAGTTTATACCACCAAACCATGCCAAGACTCATATTTATTCCATGCTCATTAGAACAGCTCTTGTAATTTCCACCTTACTTGTCGGCCTTTCTCTCCCCTTTTTCGGTCTTATGATGGCATTGATTGGATCGTTGTTAACAATGCTTGTGACTTTAATACTCCCTTGTGTCTGTTACCTCAGCATTTTGAGGGGGAAAATAACATTTTTGCAGAGAGCACTTTGTCTAATAGTTATAACAGTAGGAGTTGTTGCGTCAGCATTTGGATCATATGCATCTCTCGAGAAAATCATTGAGAAATTGATGAGCGGCTGA ATGAGTCTGGAGGAGTTTATACCACCAAACCATGCCAAGACTCATATTTATTCCATGCTCATTAGAACAGCTCTTGTAATTTCCACCTTACTTGTCGGCCTTTCTCTCCCCTTTTTCGGTCTTATGATGGCATTGATTGGATCGTTGTTAACAATGCTTGTGACTTTAATACTCCCTTGTGTCTGTTACCTCAGCATTTTGAGGGGGAAAATAACATTTTTGCAGAGAGCACTTTGTCTAATAGTTATAACAGTAGGAGTTGTTGCGTCAGCATTTGGATCATATGCATCTCTCGAGAAAATCATTGAGAAATTGATGAGCGGCTGA MSLEEFIPPNHAKTHIYSMLIRTALVISTLLVGLSLPFFGLMMALIGSLLTMLVTLILPCVCYLSILRGKITFLQRALCLIVITVGVVASAFGSYASLEKIIEKLMSG Homology
BLAST of Moc04g33780 vs. NCBI nr
Match: XP_022134364.1 (amino acid transporter AVT1C-like [Momordica charantia]) HSP 1 Score: 194.1 bits (492), Expect = 6.1e-46 Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 0
BLAST of Moc04g33780 vs. NCBI nr
Match: XP_023550515.1 (amino acid transporter AVT1C-like [Cucurbita pepo subsp. pepo] >XP_023550517.1 amino acid transporter AVT1C-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 169.9 bits (429), Expect = 1.2e-38 Identity = 92/105 (87.62%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Moc04g33780 vs. NCBI nr
Match: XP_022938397.1 (amino acid transporter AVT1C-like [Cucurbita moschata] >XP_022938398.1 amino acid transporter AVT1C-like [Cucurbita moschata] >XP_022938399.1 amino acid transporter AVT1C-like [Cucurbita moschata]) HSP 1 Score: 169.9 bits (429), Expect = 1.2e-38 Identity = 92/105 (87.62%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Moc04g33780 vs. NCBI nr
Match: XP_022993096.1 (amino acid transporter AVT1C-like [Cucurbita maxima] >XP_022993097.1 amino acid transporter AVT1C-like [Cucurbita maxima] >XP_022993098.1 amino acid transporter AVT1C-like [Cucurbita maxima]) HSP 1 Score: 169.9 bits (429), Expect = 1.2e-38 Identity = 92/105 (87.62%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Moc04g33780 vs. NCBI nr
Match: KAG7016299.1 (Amino acid transporter AVT1C, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 169.9 bits (429), Expect = 1.2e-38 Identity = 92/105 (87.62%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy Swiss-Prot
Match: F4IUW3 (Amino acid transporter AVT1C OS=Arabidopsis thaliana OX=3702 GN=AVT1C PE=1 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 6.6e-27 Identity = 66/105 (62.86%), Postives = 85/105 (80.95%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy Swiss-Prot
Match: F4JE35 (Amino acid transporter AVT1B OS=Arabidopsis thaliana OX=3702 GN=AVT1B PE=3 SV=2) HSP 1 Score: 120.9 bits (302), Expect = 8.6e-27 Identity = 65/105 (61.90%), Postives = 85/105 (80.95%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy Swiss-Prot
Match: Q8GYS4 (Amino acid transporter AVT1D OS=Arabidopsis thaliana OX=3702 GN=AVT1D PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.6e-19 Identity = 52/105 (49.52%), Postives = 74/105 (70.48%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy Swiss-Prot
Match: Q8LPF4 (Amino acid transporter AVT1E OS=Arabidopsis thaliana OX=3702 GN=AVT1E PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.3e-17 Identity = 46/107 (42.99%), Postives = 77/107 (71.96%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy Swiss-Prot
Match: Q1PER9 (Amino acid transporter AVT1G OS=Arabidopsis thaliana OX=3702 GN=AVT1G PE=2 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.0e-15 Identity = 45/106 (42.45%), Postives = 74/106 (69.81%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy TrEMBL
Match: A0A6J1BYK6 (amino acid transporter AVT1C-like OS=Momordica charantia OX=3673 GN=LOC111006645 PE=3 SV=1) HSP 1 Score: 194.1 bits (492), Expect = 3.0e-46 Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy TrEMBL
Match: A0A6J1K167 (amino acid transporter AVT1C-like OS=Cucurbita maxima OX=3661 GN=LOC111489216 PE=3 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 6.0e-39 Identity = 92/105 (87.62%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy TrEMBL
Match: A0A6J1FIS2 (amino acid transporter AVT1C-like OS=Cucurbita moschata OX=3662 GN=LOC111444660 PE=3 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 6.0e-39 Identity = 92/105 (87.62%), Postives = 99/105 (94.29%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy TrEMBL
Match: A0A0A0KG55 (Aa_trans domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G406020 PE=3 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 1.5e-37 Identity = 89/107 (83.18%), Postives = 100/107 (93.46%), Query Frame = 0
BLAST of Moc04g33780 vs. ExPASy TrEMBL
Match: A0A6J1H171 (amino acid transporter AVT1C-like isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111459494 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 2.1e-36 Identity = 87/105 (82.86%), Postives = 96/105 (91.43%), Query Frame = 0
BLAST of Moc04g33780 vs. TAIR 10
Match: AT2G39130.1 (Transmembrane amino acid transporter family protein ) HSP 1 Score: 121.3 bits (303), Expect = 4.7e-28 Identity = 66/105 (62.86%), Postives = 85/105 (80.95%), Query Frame = 0
BLAST of Moc04g33780 vs. TAIR 10
Match: AT5G02180.1 (Transmembrane amino acid transporter family protein ) HSP 1 Score: 94.7 bits (234), Expect = 4.7e-20 Identity = 52/105 (49.52%), Postives = 74/105 (70.48%), Query Frame = 0
BLAST of Moc04g33780 vs. TAIR 10
Match: AT5G02170.1 (Transmembrane amino acid transporter family protein ) HSP 1 Score: 90.5 bits (223), Expect = 8.9e-19 Identity = 46/107 (42.99%), Postives = 77/107 (71.96%), Query Frame = 0
BLAST of Moc04g33780 vs. TAIR 10
Match: AT3G09330.1 (Transmembrane amino acid transporter family protein ) HSP 1 Score: 83.2 bits (204), Expect = 1.4e-16 Identity = 45/106 (42.45%), Postives = 74/106 (69.81%), Query Frame = 0
BLAST of Moc04g33780 vs. TAIR 10
Match: AT3G09340.1 (Transmembrane amino acid transporter family protein ) HSP 1 Score: 82.8 bits (203), Expect = 1.9e-16 Identity = 44/106 (41.51%), Postives = 75/106 (70.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|