Moc04g05150 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTCCGTTTGATAAACAGCCCAAGGAAATCGTCGTCGACTGTTCCAAAGGGGTTTTTCGCAGTCTACGTTGGAGAAACCCAGAAGAGACGACATGTGATTCCGATATCTTTCTTGAAGCATCCGTCGTTTCAAGATCTGTTGAGTAAAGCCGAAGAAGAGTTCGGATTCGATCATCCAATGGGGGGTTTGACGATCCCTTGCAACGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCGAATTCTTGA ATGGGATTCCGTTTGATAAACAGCCCAAGGAAATCGTCGTCGACTGTTCCAAAGGGGTTTTTCGCAGTCTACGTTGGAGAAACCCAGAAGAGACGACATGTGATTCCGATATCTTTCTTGAAGCATCCGTCGTTTCAAGATCTGTTGAGTAAAGCCGAAGAAGAGTTCGGATTCGATCATCCAATGGGGGGTTTGACGATCCCTTGCAACGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCGAATTCTTGA ATGGGATTCCGTTTGATAAACAGCCCAAGGAAATCGTCGTCGACTGTTCCAAAGGGGTTTTTCGCAGTCTACGTTGGAGAAACCCAGAAGAGACGACATGTGATTCCGATATCTTTCTTGAAGCATCCGTCGTTTCAAGATCTGTTGAGTAAAGCCGAAGAAGAGTTCGGATTCGATCATCCAATGGGGGGTTTGACGATCCCTTGCAACGAAGATGTGTTCTTCGAAGTCACTTCTCGCTTGGCGAATTCTTGA MGFRLINSPRKSSSTVPKGFFAVYVGETQKRRHVIPISFLKHPSFQDLLSKAEEEFGFDHPMGGLTIPCNEDVFFEVTSRLANS Homology
BLAST of Moc04g05150 vs. NCBI nr
Match: XP_022135747.1 (auxin-responsive protein SAUR21-like [Momordica charantia]) HSP 1 Score: 177.6 bits (449), Expect = 4.6e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Moc04g05150 vs. NCBI nr
Match: XP_022952260.1 (auxin-responsive protein SAUR21-like [Cucurbita moschata] >XP_022969521.1 auxin-responsive protein SAUR21-like [Cucurbita maxima] >XP_023554332.1 auxin-responsive protein SAUR21-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 172.2 bits (435), Expect = 1.9e-39 Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of Moc04g05150 vs. NCBI nr
Match: XP_011658572.1 (auxin-responsive protein SAUR21 [Cucumis sativus] >KGN43197.1 hypothetical protein Csa_020466 [Cucumis sativus]) HSP 1 Score: 172.2 bits (435), Expect = 1.9e-39 Identity = 81/83 (97.59%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Moc04g05150 vs. NCBI nr
Match: XP_008448012.1 (PREDICTED: auxin-responsive protein SAUR21-like [Cucumis melo] >KAA0049686.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa] >TYK12186.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa]) HSP 1 Score: 168.3 bits (425), Expect = 2.8e-38 Identity = 79/83 (95.18%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of Moc04g05150 vs. NCBI nr
Match: KAG2335211.1 (hypothetical protein Bca52824_006391 [Brassica carinata]) HSP 1 Score: 124.8 bits (312), Expect = 3.6e-25 Identity = 55/72 (76.39%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy Swiss-Prot
Match: Q9FJF9 (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana OX=3702 GN=SAUR21 PE=2 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.3e-25 Identity = 51/72 (70.83%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy Swiss-Prot
Match: Q9FK62 (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana OX=3702 GN=SAUR24 PE=2 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.2e-25 Identity = 50/78 (64.10%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy Swiss-Prot
Match: Q9FJG0 (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana OX=3702 GN=SAUR20 PE=1 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.8e-25 Identity = 50/77 (64.94%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy Swiss-Prot
Match: Q9FJF7 (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana OX=3702 GN=SAUR22 PE=2 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 3.7e-25 Identity = 49/78 (62.82%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy Swiss-Prot
Match: Q9FJF6 (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana OX=3702 GN=SAUR23 PE=2 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 6.3e-25 Identity = 50/78 (64.10%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy TrEMBL
Match: A0A6J1C3M2 (auxin-responsive protein SAUR21-like OS=Momordica charantia OX=3673 GN=LOC111007637 PE=3 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.2e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy TrEMBL
Match: A0A6J1HY12 (auxin-responsive protein SAUR21-like OS=Cucurbita maxima OX=3661 GN=LOC111468496 PE=3 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 9.4e-40 Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy TrEMBL
Match: A0A0A0K4I7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008440 PE=3 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 9.4e-40 Identity = 81/83 (97.59%), Postives = 82/83 (98.80%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy TrEMBL
Match: A0A6J1GL96 (auxin-responsive protein SAUR21-like OS=Cucurbita moschata OX=3662 GN=LOC111454990 PE=3 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 9.4e-40 Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of Moc04g05150 vs. ExPASy TrEMBL
Match: A0A5D3CP52 (Auxin-responsive protein SAUR21-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold106G001290 PE=3 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 1.4e-38 Identity = 79/83 (95.18%), Postives = 81/83 (97.59%), Query Frame = 0
BLAST of Moc04g05150 vs. TAIR 10
Match: AT5G18030.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.7 bits (291), Expect = 9.0e-27 Identity = 51/72 (70.83%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of Moc04g05150 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.9 bits (289), Expect = 1.5e-26 Identity = 50/78 (64.10%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Moc04g05150 vs. TAIR 10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.5 bits (288), Expect = 2.0e-26 Identity = 50/77 (64.94%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of Moc04g05150 vs. TAIR 10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.2 bits (287), Expect = 2.6e-26 Identity = 49/78 (62.82%), Postives = 64/78 (82.05%), Query Frame = 0
BLAST of Moc04g05150 vs. TAIR 10
Match: AT5G18060.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.4 bits (285), Expect = 4.5e-26 Identity = 50/78 (64.10%), Postives = 63/78 (80.77%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|