Moc02g09860 (gene) Bitter gourd (OHB3-1) v2
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAATCCGTTTGCCATCAATTCTTCTTAATGCCAAACAGATTCTGAAAATGCAAGCTATGTCTGCCAGAAATCAGTCAGATGTTCCTAAAGGCTACATTGCAGTTTATGTGGGAGAGATTCAGAGGAAGAGATTTGTGGTACCTATTTCGTACTTGAAGCATCCTTCTTTTGTAGATCTGCTCAATAGGTCAGAAGAAGAGTTCGGATTCTGCCATCCAATGGGCGGCTTGACGATTCCGTGCAGAGAAGATGCCTTCATAAATCTAACTTCTAGGCTGCACACATCATGA ATGGGAATCCGTTTGCCATCAATTCTTCTTAATGCCAAACAGATTCTGAAAATGCAAGCTATGTCTGCCAGAAATCAGTCAGATGTTCCTAAAGGCTACATTGCAGTTTATGTGGGAGAGATTCAGAGGAAGAGATTTGTGGTACCTATTTCGTACTTGAAGCATCCTTCTTTTGTAGATCTGCTCAATAGGTCAGAAGAAGAGTTCGGATTCTGCCATCCAATGGGCGGCTTGACGATTCCGTGCAGAGAAGATGCCTTCATAAATCTAACTTCTAGGCTGCACACATCATGA ATGGGAATCCGTTTGCCATCAATTCTTCTTAATGCCAAACAGATTCTGAAAATGCAAGCTATGTCTGCCAGAAATCAGTCAGATGTTCCTAAAGGCTACATTGCAGTTTATGTGGGAGAGATTCAGAGGAAGAGATTTGTGGTACCTATTTCGTACTTGAAGCATCCTTCTTTTGTAGATCTGCTCAATAGGTCAGAAGAAGAGTTCGGATTCTGCCATCCAATGGGCGGCTTGACGATTCCGTGCAGAGAAGATGCCTTCATAAATCTAACTTCTAGGCTGCACACATCATGA MGIRLPSILLNAKQILKMQAMSARNQSDVPKGYIAVYVGEIQRKRFVVPISYLKHPSFVDLLNRSEEEFGFCHPMGGLTIPCREDAFINLTSRLHTS Homology
BLAST of Moc02g09860 vs. NCBI nr
Match: XP_022146171.1 (auxin-responsive protein SAUR21-like [Momordica charantia]) HSP 1 Score: 199.5 bits (506), Expect = 1.3e-47 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Moc02g09860 vs. NCBI nr
Match: XP_011649278.1 (auxin-responsive protein SAUR21 [Cucumis sativus]) HSP 1 Score: 196.1 bits (497), Expect = 1.4e-46 Identity = 94/97 (96.91%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Moc02g09860 vs. NCBI nr
Match: XP_008457639.1 (PREDICTED: auxin-responsive protein SAUR21-like [Cucumis melo] >KAA0045682.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa] >TYJ99602.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa]) HSP 1 Score: 195.7 bits (496), Expect = 1.9e-46 Identity = 94/97 (96.91%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Moc02g09860 vs. NCBI nr
Match: XP_038901157.1 (auxin-responsive protein SAUR21-like [Benincasa hispida]) HSP 1 Score: 194.9 bits (494), Expect = 3.2e-46 Identity = 93/97 (95.88%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Moc02g09860 vs. NCBI nr
Match: XP_038901158.1 (auxin-responsive protein SAUR21-like [Benincasa hispida]) HSP 1 Score: 193.4 bits (490), Expect = 9.4e-46 Identity = 91/97 (93.81%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy Swiss-Prot
Match: Q9FJF6 (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana OX=3702 GN=SAUR23 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.9e-25 Identity = 58/87 (66.67%), Postives = 69/87 (79.31%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy Swiss-Prot
Match: Q9FJG1 (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana OX=3702 GN=SAUR19 PE=2 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 7.3e-25 Identity = 56/86 (65.12%), Postives = 67/86 (77.91%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy Swiss-Prot
Match: Q9FJG0 (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana OX=3702 GN=SAUR20 PE=1 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 9.5e-25 Identity = 56/85 (65.88%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy Swiss-Prot
Match: Q9FJF9 (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana OX=3702 GN=SAUR21 PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 9.5e-25 Identity = 56/86 (65.12%), Postives = 66/86 (76.74%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy Swiss-Prot
Match: Q9FK62 (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana OX=3702 GN=SAUR24 PE=2 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-24 Identity = 56/86 (65.12%), Postives = 67/86 (77.91%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy TrEMBL
Match: A0A6J1CYI0 (auxin-responsive protein SAUR21-like OS=Momordica charantia OX=3673 GN=LOC111015450 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 6.3e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy TrEMBL
Match: A0A5D3BIN4 (Auxin-responsive protein SAUR21-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold123G001760 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 9.2e-47 Identity = 94/97 (96.91%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy TrEMBL
Match: A0A1S3C631 (auxin-responsive protein SAUR21-like OS=Cucumis melo OX=3656 GN=LOC103497287 PE=3 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 9.2e-47 Identity = 94/97 (96.91%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy TrEMBL
Match: A0A5A7TQ57 (Auxin-responsive protein SAUR21-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold123G001750 PE=3 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 5.9e-46 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Moc02g09860 vs. ExPASy TrEMBL
Match: A0A1S4E2E4 (auxin-responsive protein SAUR21-like OS=Cucumis melo OX=3656 GN=LOC107991554 PE=3 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 5.9e-46 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Moc02g09860 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 123.2 bits (308), Expect = 1.1e-28 Identity = 59/99 (59.60%), Postives = 75/99 (75.76%), Query Frame = 0
BLAST of Moc02g09860 vs. TAIR 10
Match: AT2G21210.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.1 bits (292), Expect = 8.0e-27 Identity = 57/98 (58.16%), Postives = 76/98 (77.55%), Query Frame = 0
BLAST of Moc02g09860 vs. TAIR 10
Match: AT5G18060.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.3 bits (290), Expect = 1.4e-26 Identity = 58/87 (66.67%), Postives = 69/87 (79.31%), Query Frame = 0
BLAST of Moc02g09860 vs. TAIR 10
Match: AT5G18010.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.4 bits (285), Expect = 5.2e-26 Identity = 56/86 (65.12%), Postives = 67/86 (77.91%), Query Frame = 0
BLAST of Moc02g09860 vs. TAIR 10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.0 bits (284), Expect = 6.7e-26 Identity = 56/85 (65.88%), Postives = 66/85 (77.65%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (OHB3-1) v2
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|