MS027932 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTTCGTTTGGCGAAAATTGTAAATGCGGTACAAAATCTTGGACTTTCTTCTCTAACAAAAAAGCATGGATCTTCAACAATCCGTAAAGGTAATTATGCAATTTATGTTGGAGAGAGCCAAAGGAATCGGTTTGTGATTCCAATAGCTTACTTGCATCGGCCATATTTCAAGGACTTGCTCAGTCAAGCTGAAGAAGAATTTGGATACGATCACCCTATGGGAGGCCTCACCATTCCATGCAATGATGATACATTCATTGATTTCGTCTCTCGTTTGAATGAGTTGTGA ATGGGTTTTCGTTTGGCGAAAATTGTAAATGCGGTACAAAATCTTGGACTTTCTTCTCTAACAAAAAAGCATGGATCTTCAACAATCCGTAAAGGTAATTATGCAATTTATGTTGGAGAGAGCCAAAGGAATCGGTTTGTGATTCCAATAGCTTACTTGCATCGGCCATATTTCAAGGACTTGCTCAGTCAAGCTGAAGAAGAATTTGGATACGATCACCCTATGGGAGGCCTCACCATTCCATGCAATGATGATACATTCATTGATTTCGTCTCTCGTTTGAATGAGTTGTGA ATGGGTTTTCGTTTGGCGAAAATTGTAAATGCGGTACAAAATCTTGGACTTTCTTCTCTAACAAAAAAGCATGGATCTTCAACAATCCGTAAAGGTAATTATGCAATTTATGTTGGAGAGAGCCAAAGGAATCGGTTTGTGATTCCAATAGCTTACTTGCATCGGCCATATTTCAAGGACTTGCTCAGTCAAGCTGAAGAAGAATTTGGATACGATCACCCTATGGGAGGCCTCACCATTCCATGCAATGATGATACATTCATTGATTTCGTCTCTCGTTTGAATGAGTTGTGA MGFRLAKIVNAVQNLGLSSLTKKHGSSTIRKGNYAIYVGESQRNRFVIPIAYLHRPYFKDLLSQAEEEFGYDHPMGGLTIPCNDDTFIDFVSRLNEL Homology
BLAST of MS027932 vs. NCBI nr
Match: XP_022146117.1 (auxin-responsive protein SAUR21-like [Momordica charantia]) HSP 1 Score: 198.4 bits (503), Expect = 2.9e-47 Identity = 95/97 (97.94%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of MS027932 vs. NCBI nr
Match: XP_038902470.1 (auxin-induced protein 15A-like [Benincasa hispida]) HSP 1 Score: 161.8 bits (408), Expect = 3.0e-36 Identity = 74/96 (77.08%), Postives = 86/96 (89.58%), Query Frame = 0
BLAST of MS027932 vs. NCBI nr
Match: XP_022146118.1 (auxin-responsive protein SAUR24-like [Momordica charantia]) HSP 1 Score: 157.1 bits (396), Expect = 7.5e-35 Identity = 72/96 (75.00%), Postives = 85/96 (88.54%), Query Frame = 0
BLAST of MS027932 vs. NCBI nr
Match: XP_008457943.1 (PREDICTED: auxin-responsive protein SAUR21-like [Cucumis melo] >KAA0045665.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa] >TYJ99618.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa]) HSP 1 Score: 157.1 bits (396), Expect = 7.5e-35 Identity = 73/96 (76.04%), Postives = 84/96 (87.50%), Query Frame = 0
BLAST of MS027932 vs. NCBI nr
Match: KAG6605034.1 (Auxin-responsive protein SAUR24, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 154.5 bits (389), Expect = 4.8e-34 Identity = 71/96 (73.96%), Postives = 83/96 (86.46%), Query Frame = 0
BLAST of MS027932 vs. ExPASy Swiss-Prot
Match: P33079 (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.2e-21 Identity = 50/97 (51.55%), Postives = 67/97 (69.07%), Query Frame = 0
BLAST of MS027932 vs. ExPASy Swiss-Prot
Match: Q9FJF9 (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana OX=3702 GN=SAUR21 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 6.4e-21 Identity = 44/80 (55.00%), Postives = 61/80 (76.25%), Query Frame = 0
BLAST of MS027932 vs. ExPASy Swiss-Prot
Match: P33080 (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 8.3e-21 Identity = 48/97 (49.48%), Postives = 66/97 (68.04%), Query Frame = 0
BLAST of MS027932 vs. ExPASy Swiss-Prot
Match: Q9FK62 (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana OX=3702 GN=SAUR24 PE=2 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.2e-20 Identity = 42/68 (61.76%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of MS027932 vs. ExPASy Swiss-Prot
Match: Q9FJF7 (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana OX=3702 GN=SAUR22 PE=2 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.1e-20 Identity = 41/68 (60.29%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MS027932 vs. ExPASy TrEMBL
Match: A0A6J1CYP6 (auxin-responsive protein SAUR21-like OS=Momordica charantia OX=3673 GN=LOC111015412 PE=3 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 1.4e-47 Identity = 95/97 (97.94%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of MS027932 vs. ExPASy TrEMBL
Match: A0A5D3BN78 (Auxin-responsive protein SAUR21-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold123G001920 PE=3 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 3.6e-35 Identity = 73/96 (76.04%), Postives = 84/96 (87.50%), Query Frame = 0
BLAST of MS027932 vs. ExPASy TrEMBL
Match: A0A6J1CXQ4 (auxin-responsive protein SAUR24-like OS=Momordica charantia OX=3673 GN=LOC111015414 PE=3 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 3.6e-35 Identity = 72/96 (75.00%), Postives = 85/96 (88.54%), Query Frame = 0
BLAST of MS027932 vs. ExPASy TrEMBL
Match: A0A1S3C683 (auxin-responsive protein SAUR21-like OS=Cucumis melo OX=3656 GN=LOC103497507 PE=3 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 3.6e-35 Identity = 73/96 (76.04%), Postives = 84/96 (87.50%), Query Frame = 0
BLAST of MS027932 vs. ExPASy TrEMBL
Match: A0A0A0LIY4 (SAUR family protein OS=Cucumis sativus OX=3659 GN=Csa_2G258610 PE=3 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 1.2e-33 Identity = 69/96 (71.88%), Postives = 83/96 (86.46%), Query Frame = 0
BLAST of MS027932 vs. TAIR 10
Match: AT2G21210.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.7 bits (252), Expect = 3.5e-22 Identity = 48/96 (50.00%), Postives = 67/96 (69.79%), Query Frame = 0
BLAST of MS027932 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.3 bits (251), Expect = 4.5e-22 Identity = 46/99 (46.46%), Postives = 66/99 (66.67%), Query Frame = 0
BLAST of MS027932 vs. TAIR 10
Match: AT5G18030.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 101.3 bits (251), Expect = 4.5e-22 Identity = 44/80 (55.00%), Postives = 61/80 (76.25%), Query Frame = 0
BLAST of MS027932 vs. TAIR 10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 99.0 bits (245), Expect = 2.2e-21 Identity = 42/68 (61.76%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of MS027932 vs. TAIR 10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 98.6 bits (244), Expect = 2.9e-21 Identity = 41/68 (60.29%), Postives = 58/68 (85.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|